Recombinant Human PHOSPHO2 protein (ab116206)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ8TCD6
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMKILLVFDFDNTIIDDNSDTWIVQCA PNKKLPIELRDSYRKGFWTEFMGRVFKYLGDKGVREHEMKRAVTSLPFTP GMVELFNFIRKNKDKFDCIIISDSNSVFIDWVLEAASFHDIFDKVFTNPA AFNSNGHLTVENYHTHSCNRCPKNLCKKVVLIEFVDKQLQQGVNYTQIVY IGDGGNDVCPVTFLKNDDVAMPRKGYTLQKTLSRMSQNLEPMEYSVVVWS SGVDIISHLQFLIKD
    • Molecular weight30 kDa including tags
    • Amino acids1 to 241
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116206 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 85 % SDS-PAGE.
    ab116206 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • EC=3.1.3.74
    • MGC111048
    • MGC22679
    • OTTHUMP00000204770
    • OTTHUMP00000204771
    • OTTHUMP00000204772
    • PHOP2_HUMAN
    • phosphatase, orphan 2
    • PHOSPHO2
    • Pyridoxal phosphate phosphatase PHOSPHO2
    see all
  • FunctionPhosphatase that has high activity toward pyridoxal 5'-phosphate (PLP). Also active at much lower level toward pyrophosphate, phosphoethanolamine (PEA), phosphocholine (PCho), phospho-l-tyrosine, fructose-6-phosphate, p-nitrophenyl phosphate, and h-glycerophosphate.
  • Sequence similaritiesBelongs to the HAD-like hydrolase superfamily. PHOSPHO family.
  • Information by UniProt

Recombinant Human PHOSPHO2 protein images

  • 15% SDS-PAGE analysis of 3 µg ab116206.

References for Recombinant Human PHOSPHO2 protein (ab116206)

ab116206 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116206.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"