Recombinant Human Phospholipase A2 protein (ab112338)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSFIDPYQHIIVEHQYSHKFTVVVLRATKVTKGAFGDMLDTPDPYVELFI STTPDSRKRTRHFNNDINPVWNETFEFILDPNQENVLEITLMDANYVMDE TLGTATFTVS
    • Molecular weight
      38 kDa including tags
    • Amino acids
      1 to 110
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112338 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Calcium dependent phospholipid binding protein
    • CPLA 2
    • cPLA2
    • cPLA2 alpha
    • Cytosolic phospholipase A2
    • Cytosolic phospholipase A2 group IVA
    • Lysophospholipase
    • MGC126350
    • PA24A_HUMAN
    • Phosphatidylcholine 2 acylhydrolase
    • Phosphatidylcholine 2-acylhydrolase
    • Phospholipase A2 group 4 A
    • Phospholipase A2 group IVA
    • Phospholipase A2 group IVA (cytosolic calcium dependent)
    • PhospholipaseA2
    • PLA2G4
    • pla2g4a
    see all
  • Function
    Selectively hydrolyzes arachidonyl phospholipids in the sn-2 position releasing arachidonic acid. Together with its lysophospholipid activity, it is implicated in the initiation of the inflammatory response.
  • Tissue specificity
    Expressed in various tissues such as macrophages, platelets, neutrophils, fibroblasts and lung endothelium.
  • Sequence similarities
    Contains 1 C2 domain.
    Contains 1 PLA2c domain.
  • Domain
    The N-terminal C2 domain associates with lipid membranes upon calcium binding. It modulates enzyme activity by presenting the active site to its substrate in response to elevations of cytosolic Ca(2+).
  • Post-translational
    modifications
    Activated by phosphorylation at both Ser-505 and Ser-727.
  • Cellular localization
    Cytoplasm. Cytoplasmic vesicle. Translocates to membrane vesicles in a calcium-dependent fashion.
  • Information by UniProt

Images

  • ab112338 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab112338 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112338.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up