Recombinant Human Phospholipase A2 protein (ab112338)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP47712
    • SpeciesHuman
    • SequenceMSFIDPYQHIIVEHQYSHKFTVVVLRATKVTKGAFGDMLDTPDPYVELFI STTPDSRKRTRHFNNDINPVWNETFEFILDPNQENVLEITLMDANYVMDE TLGTATFTVS
    • Molecular weight38 kDa including tags
    • Amino acids1 to 110
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112338 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Calcium dependent phospholipid binding protein
    • CPLA 2
    • cPLA2
    • cPLA2 alpha
    • Cytosolic phospholipase A2
    • Cytosolic phospholipase A2 group IVA
    • Lysophospholipase
    • MGC126350
    • PA24A_HUMAN
    • Phosphatidylcholine 2 acylhydrolase
    • Phosphatidylcholine 2-acylhydrolase
    • Phospholipase A2 group 4 A
    • Phospholipase A2 group IVA
    • Phospholipase A2 group IVA (cytosolic calcium dependent)
    • PhospholipaseA2
    • PLA2G4
    • pla2g4a
    see all
  • FunctionSelectively hydrolyzes arachidonyl phospholipids in the sn-2 position releasing arachidonic acid. Together with its lysophospholipid activity, it is implicated in the initiation of the inflammatory response.
  • Tissue specificityExpressed in various tissues such as macrophages, platelets, neutrophils, fibroblasts and lung endothelium.
  • Sequence similaritiesContains 1 C2 domain.
    Contains 1 PLA2c domain.
  • DomainThe N-terminal C2 domain associates with lipid membranes upon calcium binding. It modulates enzyme activity by presenting the active site to its substrate in response to elevations of cytosolic Ca(2+).
  • Post-translational
    modifications
    Activated by phosphorylation at both Ser-505 and Ser-727.
  • Cellular localizationCytoplasm. Cytoplasmic vesicle. Translocates to membrane vesicles in a calcium-dependent fashion.
  • Information by UniProt

Recombinant Human Phospholipase A2 protein images

  • ab112338 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Phospholipase A2 protein (ab112338)

ab112338 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112338.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"