Recombinant Human Phospholipase A2 X protein (His tag) (ab63847)

Overview

  • Product name
    Recombinant Human Phospholipase A2 X protein (His tag)
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MRGSHHHHHHGMASHMGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQ PRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQ ELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD
    • Molecular weight
      16 kDa including tags
    • Amino acids
      43 to 165
    • Tags
      His tag N-Terminus
    • Additional sequence information
      Mature chain without signal peptide, without propeptide.

Specifications

Our Abpromise guarantee covers the use of ab63847 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

  • Purity
    > 95 % SDS-PAGE.

  • Form
    Lyophilised
  • Additional notes
    Product is NOT sterile! Please filter the product by an appropriate sterile filter before using it in cell culture.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 0.01M Tris buffer, pH 7.2

  • Reconstitution
    Add deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely.

General Info

  • Alternative names
    • Group 10 secretory phospholipase A2
    • Group X secretory phospholipase A2
    • GX sPLA2
    • GXPLA2
    • GXSPLA2
    • PA2GX_HUMAN
    • Phosphatidylcholine 2 acylhydrolase GX
    • Phosphatidylcholine 2-acylhydrolase 10
    • Phospholipase A2 group X
    • PLA2G10
    • SPLA2
    • sPLA2-X
    • sPLA2X
    see all
  • Function
    PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Has a powerful potency for releasing arachidonic acid from cell membrane phospholipids. Prefers phosphatidylethanolamine and phosphatidylcholine liposomes to those of phosphatidylserine.
  • Tissue specificity
    Found in spleen, thymus, peripheral blood leukocytes, pancreas, lung, and colon.
  • Sequence similarities
    Belongs to the phospholipase A2 family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Recombinant Human Phospholipase A2 X protein (His tag) images

  • 12% SDS-PAGE separation of ab63847. Molecular Weight: ~15.5 kDa.

    Lane 1. Molecular weight marker
    Lane 2. reduced and heated sample, 5µg/lane
    Lane 3. non-reduced and non-heated sample, 5µg/lane

References for Recombinant Human Phospholipase A2 X protein (His tag) (ab63847)

ab63847 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab63847.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up