Recombinant Human Phospholipase C gamma 1 protein (ab112339)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LKNNYSEDLELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLF HGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1192 to 1291
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112339 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1 phosphatidyl D myo inositol 4 5 bisphosphate
    • 1 phosphatidylinositol 4 5 bisphosphate phosphodiesterase gamma 1
    • 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1
    • Inositoltrisphosphohydrolase
    • Monophosphatidylinositol phosphodiesterase
    • NCKAP3
    • Phosphatidylinositol phospholipase C
    • Phosphoinositidase C
    • Phosphoinositide phospholipase C
    • Phosphoinositide phospholipase C-gamma-1
    • Phospholipase C 148
    • Phospholipase C gamma 1
    • Phospholipase C-gamma-1
    • Phospholipase C-II
    • PLC gamma 1
    • PLC II
    • PLC-148
    • PLC-gamma-1
    • PLC-II
    • PLC1
    • PLC148
    • Plcg1
    • PLCG1_HUMAN
    • PLCgamma1
    see all
  • Function
    Plays a role in actin reorganization and cell migration. The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. Major substrate for heparin-binding growth factor 1 (acidic fibroblast growth factor)-activated tyrosine kinase.
  • Sequence similarities
    Contains 1 C2 domain.
    Contains 1 EF-hand domain.
    Contains 2 PH domains.
    Contains 1 PI-PLC X-box domain.
    Contains 1 PI-PLC Y-box domain.
    Contains 2 SH2 domains.
    Contains 1 SH3 domain.
  • Domain
    The SH3 domain mediates interaction with CLNK (By similarity). The SH3 domain also mediates interaction with RALGPS1.
  • Post-translational
    modifications
    The receptor-mediated activation of PLC-gamma-1 and PLC-gamma-2 involves their phosphorylation by tyrosine kinases in response to ligation of a variety of growth factor receptors and immune system receptors. May be dephosphorylated by PTPRJ.
    Ubiquitinated by CBLB in activated T-cells.
  • Cellular localization
    Cell projection > lamellipodium. Cell projection > ruffle. Rapidly redistributed to ruffles and lamellipodia structures in response to epidermal growth factor (EGF) treatment.
  • Information by UniProt

Images

  • ab112339 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab112339 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112339.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up