Recombinant Human Phospholipase C gamma 1 protein (ab112339)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP19174-2
    • SpeciesHuman
    • SequenceLKNNYSEDLELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLF HGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL
    • Molecular weight37 kDa including tags
    • Amino acids1192 to 1291
    • TagsGST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112339 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1 phosphatidyl D myo inositol 4 5 bisphosphate
    • 1 phosphatidylinositol 4 5 bisphosphate phosphodiesterase gamma 1
    • 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1
    • Inositoltrisphosphohydrolase
    • Monophosphatidylinositol phosphodiesterase
    • NCKAP3
    • Phosphatidylinositol phospholipase C
    • Phosphoinositidase C
    • Phosphoinositide phospholipase C
    • Phosphoinositide phospholipase C-gamma-1
    • Phospholipase C 148
    • Phospholipase C gamma 1
    • Phospholipase C-gamma-1
    • Phospholipase C-II
    • PLC gamma 1
    • PLC II
    • PLC-148
    • PLC-gamma-1
    • PLC-II
    • PLC1
    • PLC148
    • Plcg1
    • PLCG1_HUMAN
    • PLCgamma1
    see all
  • FunctionPlays a role in actin reorganization and cell migration. The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. Major substrate for heparin-binding growth factor 1 (acidic fibroblast growth factor)-activated tyrosine kinase.
  • Sequence similaritiesContains 1 C2 domain.
    Contains 1 EF-hand domain.
    Contains 2 PH domains.
    Contains 1 PI-PLC X-box domain.
    Contains 1 PI-PLC Y-box domain.
    Contains 2 SH2 domains.
    Contains 1 SH3 domain.
  • DomainThe SH3 domain mediates interaction with CLNK (By similarity). The SH3 domain also mediates interaction with RALGPS1.
  • Post-translational
    modifications
    The receptor-mediated activation of PLC-gamma-1 and PLC-gamma-2 involves their phosphorylation by tyrosine kinases in response to ligation of a variety of growth factor receptors and immune system receptors. May be dephosphorylated by PTPRJ.
    Ubiquitinated by CBLB in activated T-cells.
  • Cellular localizationCell projection > lamellipodium. Cell projection > ruffle. Rapidly redistributed to ruffles and lamellipodia structures in response to epidermal growth factor (EGF) treatment.
  • Information by UniProt

Recombinant Human Phospholipase C gamma 1 protein images

  • ab112339 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Phospholipase C gamma 1 protein (ab112339)

ab112339 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112339.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"