Recombinant Human Phospholipase D1 protein (ab114568)

Overview

  • Product name
    Recombinant Human Phospholipase D1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GYLDDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLI QLRDFINKPVLAKEDPIRAEEELKKIRGFLVQFPFYFLSEESLLPSVGTK EAIVPMEVWT
    • Molecular weight
      38 kDa including tags
    • Amino acids
      965 to 1074

Specifications

Our Abpromise guarantee covers the use of ab114568 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Choline phosphatase 1
    • hPLD1
    • Phosphatidylcholine-hydrolyzing phospholipase D1
    • Phospholipase D1
    • PLD 1
    • PLD1
    • PLD1_HUMAN
    see all
  • Function
    Implicated as a critical step in numerous cellular pathways, including signal transduction, membrane trafficking, and the regulation of mitosis. May be involved in the regulation of perinuclear intravesicular membrane traffic.
  • Tissue specificity
    Expressed abundantly in the pancreas and heart and at high levels in brain, placenta, spleen, uterus and small intestine.
  • Sequence similarities
    Belongs to the phospholipase D family.
    Contains 1 PH domain.
    Contains 2 PLD phosphodiesterase domains.
    Contains 1 PX (phox homology) domain.
  • Cellular localization
    Cytoplasm > perinuclear region. Endoplasmic reticulum membrane. Golgi apparatus membrane. Late endosome membrane.
  • Information by UniProt

Recombinant Human Phospholipase D1 protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human Phospholipase D1 protein (ab114568)

ab114568 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114568.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up