Recombinant Human Phospholipase D1 protein (ab114568)

Overview

  • Product name
    Recombinant Human Phospholipase D1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GYLDDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLI QLRDFINKPVLAKEDPIRAEEELKKIRGFLVQFPFYFLSEESLLPSVGTK EAIVPMEVWT
    • Molecular weight
      38 kDa including tags
    • Amino acids
      965 to 1074

Specifications

Our Abpromise guarantee covers the use of ab114568 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Choline phosphatase 1
    • hPLD1
    • Phosphatidylcholine-hydrolyzing phospholipase D1
    • Phospholipase D1
    • PLD 1
    • PLD1
    • PLD1_HUMAN
    see all
  • Function
    Implicated as a critical step in numerous cellular pathways, including signal transduction, membrane trafficking, and the regulation of mitosis. May be involved in the regulation of perinuclear intravesicular membrane traffic.
  • Tissue specificity
    Expressed abundantly in the pancreas and heart and at high levels in brain, placenta, spleen, uterus and small intestine.
  • Sequence similarities
    Belongs to the phospholipase D family.
    Contains 1 PH domain.
    Contains 2 PLD phosphodiesterase domains.
    Contains 1 PX (phox homology) domain.
  • Cellular localization
    Cytoplasm > perinuclear region. Endoplasmic reticulum membrane. Golgi apparatus membrane. Late endosome membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References

ab114568 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114568.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up