Recombinant Human Phosphoribosyl pyrophosphate amidotransferase protein (ab159164)

Overview

  • Product name
    Recombinant Human Phosphoribosyl pyrophosphate amidotransferase protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MELEELGIREECGVFGCIASGEWPTQLDVPHVITLGLVGLQHRGQESAGI VTSDGSSVPTFKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKC ELENCQPFVVETLHGKIAVAHNGELVNAARLRKKLLRHGIGLSTSSDSEM ITQLLAYTPPQEQDDTPDWVARIKNLMKEAPTAYSLLIMHRDVIYAVRDP YGNRPLCIGRLIPVSDINDKEKKTSETEGWVVSSESCSFLSIGARYYREV LPGEIVEISRHNVQTLDIISRSEGNPVAFCIFEYVYFARPDSMFEDQMVY TVRYRCGQQLAIEAPVDADLVSTVPESATPAALAYAGKCGLPYVEVLCKN RYVGRTFIQPNMRLRQLGVAKKFGVLSDNFKGKRIVLVDDSIVRGNTISP IIKLLKESGAKEVHIRVASPPIKYPCFMGINIPTKEELIANKPEFDHLAE YLGANSVVYLSVEGLVSSVQEGIKFKKQKEKKHDIMIQENGNGLECFEKS GHCTACLTGKYPVELEW
    • Amino acids
      1 to 517
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159164 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Amidophosphoribosyltransferase
    • Amidophosphoribosyltransferase [Precursor]
    • ATase
    • Glutamine phosphoribosylpyrophosphatate amidotransferase
    • Glutamine phosphoribosylpyrophosphate amidotransferase
    • Glutamine PRPP amidotransferase
    • GPAT
    • Phosphoribosyl pyrophosphate amidotransferase
    • Ppat
    • PRAT
    • PUR1_HUMAN
    see all
  • Tissue specificity
    Ubiquitously expressed.
  • Pathway
    Purine metabolism; IMP biosynthesis via de novo pathway; N(1)-(5-phospho-D-ribosyl)glycinamide from 5-phospho-alpha-D-ribose 1-diphosphate: step 1/2.
  • Sequence similarities
    In the C-terminal section; belongs to the purine/pyrimidine phosphoribosyltransferase family.
    Contains 1 glutamine amidotransferase type-2 domain.
  • Information by UniProt

Images

  • ab159164 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159164 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159164.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up