Recombinant Human Phosphorylase B protein (ab159110)

Overview

  • Product name
    Recombinant Human Phosphorylase B protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EDTLGNIDQPQYRQIVVELLMVVSIVLERNPELEFQDKVDLDRLVKEAFN EFQKDQSRLKEIEKQDDMTSFYNTPPLGKRGTCSYLTKAVMNLLLEGEVK PNNDDPCLIS
    • Amino acids
      984 to 1093
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159110 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp781E15103
    • FLJ41698
    • KPBB_HUMAN
    • PHKB
    • Phosphorylase b kinase regulatory subunit beta
    • Phosphorylase kinase B
    • Phosphorylase kinase beta polypeptide
    • Phosphorylase kinase beta subunit
    • Phosphorylase kinase subunit beta
    see all
  • Function
    Phosphorylase b kinase catalyzes the phosphorylation of serine in certain substrates, including troponin I. The beta chain acts as a regulatory unit and modulates the activity of the holoenzyme in response to phosphorylation.
  • Pathway
    Glycan biosynthesis; glycogen metabolism.
  • Involvement in disease
    Glycogen storage disease 9B
  • Sequence similarities
    Belongs to the phosphorylase b kinase regulatory chain family.
  • Post-translational
    modifications
    Ser-701 is probably phosphorylated by PKA.
    Although the final Cys may be farnesylated, the terminal tripeptide is probably not removed, and the C-terminus is not methylated.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab159110 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159110 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159110.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up