Overview

  • Product name
    Recombinant Human PHPT1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAVADLALIPDVDIDSDGVFKYVLIRVHSA PRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRIS HQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
    • Molecular weight
      16 kDa
    • Amino acids
      1 to 125
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99865 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab99865 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • PHP14
    • 14 kDa phosphohistidine phosphatase
    • CGI 202
    • HSPC141
    • Phosphohistidine phosphatase 1
    • PHPT 1
    • Protein janus A homolog
    see all
  • Relevance
    PHPT1 is an EDTA-insensitive phosphohistidine phosphatase that catalyzes the dephosphorylation of phosphopeptide I. Protein histidine phosphorylation and dephosphorylation in eukaryotes has been sparsely studied compared to protein serine/threonine and tyrosine phosphorylation, although protein histidine phosphorylation is estimated to account for about 6% of total protein phosphorylation in eukaryotes. Ek et al. (2002) detected no activity of PHPT1 towards phosphoserine, phosphothreonine, or phosphotyrosine peptides.
  • Cellular localization
    Cytoplasmic

Recombinant Human PHPT1 protein images

  • 15% SDS-PAGE showing ab99865 (3µg).

References for Recombinant Human PHPT1 protein (ab99865)

ab99865 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99865.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up