Overview

  • Product name
    Recombinant Human PHPT1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAVADLALIPDVDIDSDGVFKYVLIRVHSA PRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRIS HQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
    • Molecular weight
      16 kDa
    • Amino acids
      1 to 125
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99865 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab99865 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • PHP14
    • 14 kDa phosphohistidine phosphatase
    • CGI 202
    • HSPC141
    • Phosphohistidine phosphatase 1
    • PHPT 1
    • Protein janus A homolog
    see all
  • Relevance
    PHPT1 is an EDTA-insensitive phosphohistidine phosphatase that catalyzes the dephosphorylation of phosphopeptide I. Protein histidine phosphorylation and dephosphorylation in eukaryotes has been sparsely studied compared to protein serine/threonine and tyrosine phosphorylation, although protein histidine phosphorylation is estimated to account for about 6% of total protein phosphorylation in eukaryotes. Ek et al. (2002) detected no activity of PHPT1 towards phosphoserine, phosphothreonine, or phosphotyrosine peptides.
  • Cellular localization
    Cytoplasmic

Images

  • 15% SDS-PAGE showing ab99865 (3µg).

References

ab99865 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99865.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up