Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MALVRGGWLWRQSSILRRWKRNWFALWLDGTLGYYHDETAQDEEDRVLIH FNVRDIKIGPECHDVQPPEGRSRDGLLTVNLREGGRLHLCAETKDDALAW KTALLEANSTPVRVYSPYQDYYEVVPPNAHEATYVRSYYGPPYAGPGVTH VIVREDPCYSAGAPLAMGMLAGAATGAALGSLMWSPCWF
    • Amino acids
      1 to 189
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163670 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AI315628
    • Evectin 1
    • evt 1
    • Kpl1
    • MGC93114
    • PH domain containing protein in retina 1
    • PH domain containing, retinal 1
    • PHR1
    • Phret1
    • Pleckstrin homology domain containing, family B (evectins) member 1
    • Pleckstrin homology domain retinal protein 1
    • PLEKHB1
    see all
  • Relevance
    PHR1 contains 1 PH domain, interacts with MYO1C and binds transducins.
  • Cellular localization
    Membrane. Note: Membrane-associated. Highly expressed in the outer segments of photoreceptor cells, both in rods and cones.

Images

  • ab163670 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163670 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163670.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up