Recombinant Human PI 3 Kinase catalytic subunit alpha protein (ab159127)

Overview

  • Product name
    Recombinant Human PI 3 Kinase catalytic subunit alpha protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGS GMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWI FHTIKQHALN
    • Amino acids
      959 to 1068
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159127 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha
    • 5-bisphosphate 3-kinase catalytic subunit alpha isoform
    • caPI3K
    • CLOVE
    • CWS5
    • MCAP
    • MCM
    • MCMTC
    • MGC142161
    • MGC142163
    • p110 alpha
    • p110alpha
    • Phosphatidylinositol 3 kinase catalytic alpha polypeptide
    • Phosphatidylinositol 3 kinase catalytic 110 KD alpha
    • Phosphatidylinositol 4 5 bisphosphate 3 kinase catalytic subunit alpha
    • Phosphatidylinositol 4 5 bisphosphate 3 kinase catalytic subunit alpha isoform
    • Phosphatidylinositol 4,5 bisphosphate 3 kinase 110 kDa catalytic subunit alpha
    • Phosphatidylinositol-4
    • Phosphoinositide 3 kinase catalytic alpha polypeptide
    • PI3 kinase p110 subunit alpha
    • PI3-kinase subunit alpha
    • PI3K
    • PI3K-alpha
    • PI3KC A
    • PIK3C A
    • Pik3ca
    • PK3CA
    • PK3CA_HUMAN
    • PtdIns 3 kinase p110
    • PtdIns-3-kinase subunit alpha
    • PtdIns-3-kinase subunit p110-alpha
    • Serine/threonine protein kinase PIK3CA
    see all
  • Function
    Phosphorylates PtdIns, PtdIns4P and PtdIns(4,5)P2 with a preference for PtdIns(4,5)P2.
  • Involvement in disease
    Defects in PIK3CA are associated with colorectal cancer (CRC) [MIM:114500].
    Defects in PIK3CA are a cause of susceptibility to breast cancer (BC) [MIM:114480]. A common malignancy originating from breast epithelial tissue. Breast neoplasms can be distinguished by their histologic pattern. Invasive ductal carcinoma is by far the most common type. Breast cancer is etiologically and genetically heterogeneous. Important genetic factors have been indicated by familial occurrence and bilateral involvement. Mutations at more than one locus can be involved in different families or even in the same case.
    Defects in PIK3CA are a cause of susceptibility to ovarian cancer (OC) [MIM:167000]. Ovarian cancer common malignancy originating from ovarian tissue. Although many histologic types of ovarian neoplasms have been described, epithelial ovarian carcinoma is the most common form. Ovarian cancers are often asymptomatic and the recognized signs and symptoms, even of late-stage disease, are vague. Consequently, most patients are diagnosed with advanced disease.
    Defects in PIK3CA may underlie hepatocellular carcinoma (HCC) [MIM:114550].
    Defects in PIK3CA are a cause of keratosis seborrheic (KERSEB) [MIM:182000]. A common benign skin tumor. Seborrheic keratoses usually begin with the appearance of one or more sharply defined, light brown, flat macules. The lesions may be sparse or numerous. As they initially grow, they develop a velvety to finely verrucous surface, followed by an uneven warty surface with multiple plugged follicles and a dull or lackluster appearance.
  • Sequence similarities
    Belongs to the PI3/PI4-kinase family.
    Contains 1 C2 domain.
    Contains 1 PI3K/PI4K domain.
  • Information by UniProt

Images

  • ab159127 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159127 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159127.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up