Recombinant Human PI 3 Kinase Class 3 protein (ab152608)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGEAEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLY QETCSDLYVTCQVFAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDL PRNAQVALTIWDVYGPGKAVPVGGTTVSLFGKYGMFRQGMHDLKVWPNVE ADGSEPTKTPGRTSSTLSEDQMSRLAKLTKAHRQGHMVKVDWLDRLTFRE IEMINESEKRSSNFMYLMVEFRCVKCDDKEYGIVYYEKDGDESSPILTSF ELVKVPDPQMSMENLVESKHHKLARSLRSGPSDHDLKPNAATRDQLNIIV SYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVNWDLPQEAKQALE LLGKWKPMDVEDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLLQLV QALKYENFDDIKNGLEPTKKDSQSSVSENVSNSGINSAEIDSSQIITSPL PSVSSPPPASKTKEVPDGENLEQDLCTFLISRACKNSTLANYLYWYVIVE CEDQDTQQRDPKTHEMYLNVMRRFSQALLKGDKSVRVMRSLLAAQQTFVD RLVHLMKAVQRESGNRKKKNERLQALLGDNEKMNLSDVELIPLPLEPQVK IRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQI ISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSI QNFFRKYAPSENGPNGISAEVMDTYVKSCAGYCVITYILGVGDRHLDNLL LTKTGKLFHIDFGYILGRDPKPLPPPMKLNKEMVEGMGGTQSEQYQEFRK QCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVKKVQDKFRLDL SDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK
    • Amino acids
      1 to 887
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152608 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hVps34
    • MGC61518
    • Phosphatidylinositol 3 kinase catalytic subunit type 3
    • Phosphatidylinositol 3 kinase class 3
    • Phosphatidylinositol 3 kinase p100 subunit
    • Phosphatidylinositol 3-kinase catalytic subunit type 3
    • Phosphatidylinositol 3-kinase p100 subunit
    • Phosphoinositide 3 kinase class 3
    • Phosphoinositide-3-kinase class 3
    • PI3 kinase type 3
    • PI3-kinase type 3
    • PI3K type 3
    • Pik3c3
    • PK3C3_HUMAN
    • PtdIns 3 kinase type 3
    • PtdIns-3-kinase type 3
    • Vps 34
    • Vps34
    see all
  • Function
    Catalytic subunit of the PI3K complex that mediates formation of phosphatidylinositol 3-phosphate. Involved in the transport of lysosomal enzyme precursors to lysosomes. Required for the abcission step in cytokinesis.
  • Tissue specificity
    Ubiquitously expressed, with a highest expression in skeletal muscle.
  • Sequence similarities
    Belongs to the PI3/PI4-kinase family.
    Contains 1 PI3K/PI4K domain.
  • Cellular localization
    Midbody.
  • Information by UniProt

Images

  • ab152608 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152608 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152608.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up