Recombinant Human PI 3 Kinase p85 alpha protein (ab159131)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      IQRIMHNYDKLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDL IQLRKTRDQYLMWLTQKGVRQKKLNEWLGNENTEDQYSLVEDDEDLPHHD EKTWNVGSSN
    • Amino acids
      251 to 360
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159131 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GRB1
    • p85
    • p85 alpha
    • P85A_HUMAN
    • Phosphatidylinositol 3 kinase associated p 85 alpha
    • Phosphatidylinositol 3 kinase regulatory 1
    • Phosphatidylinositol 3 kinase, regulatory subunit, polypeptide 1 (p85 alpha)
    • Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha
    • Phosphatidylinositol 3-kinase regulatory subunit alpha
    • Phosphoinositide 3 kinase, regulatory subunit 1 (alpha)
    • PI3 kinase p85 subunit alpha
    • PI3-kinase regulatory subunit alpha
    • PI3-kinase subunit p85-alpha
    • PI3K
    • PI3K regulatory subunit alpha
    • Pik3r1
    • PtdIns 3 kinase p85 alpha
    • PtdIns-3-kinase regulatory subunit alpha
    • PtdIns-3-kinase regulatory subunit p85-alpha
    see all
  • Function
    Binds to activated (phosphorylated) protein-Tyr kinases, through its SH2 domain, and acts as an adapter, mediating the association of the p110 catalytic unit to the plasma membrane. Necessary for the insulin-stimulated increase in glucose uptake and glycogen synthesis in insulin-sensitive tissues.
  • Tissue specificity
    Isoform 2 is expressed in skeletal muscle and brain, and at lower levels in kidney and cardiac muscle. Isoform 2 and isoform 4 are present in skeletal muscle (at protein level).
  • Sequence similarities
    Belongs to the PI3K p85 subunit family.
    Contains 1 Rho-GAP domain.
    Contains 2 SH2 domains.
    Contains 1 SH3 domain.
  • Domain
    The SH3 domain mediates the binding to CBLB, and to HIV-1 Nef.
  • Post-translational
    modifications
    Polyubiquitinated in T-cells by CBLB; which does not promote proteasomal degradation but impairs association with CD28 and CD3Z upon T-cell activation.
    Phosphorylated. Dephosphorylated by PTPRJ.
  • Information by UniProt

Images

  • ab159131 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159131 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159131.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up