Recombinant Human PI 3 Kinase p85 alpha protein (ab84769)

Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARP EEIGWLNGYN ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVA PGSSKTEADVEQQALTLPDLAE QFAPPDIAPPLLIKLVEAIEKKGLEC STLYRTQSSSNLAELRQLLDCDTPSVDLEMIDVH VLADAFKRYLLDLP NPVIPAAVYSEMISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTL QY LLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEI LISTEWNE RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISR EEVNEKLRDTADGTFLVRDA STKMHGDYTLTLRKGGNNKLIKIFHRDG KYGFSDPLTFSSVVELINHYRNESLAQYNPKL DVKLLYPVSKYQQDQV VKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMK RTAI EAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSR ISEIID SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLM WLTQKGVRQKKLNEWLGN ENTEDQYSLVEDDEDLPHHDEKTWNVGSSN RNKAENLLRGKRDGTFLVRESSKQGCYACS VVVDGEVKHCVINKTATG YGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA QQRR
    • Amino acids
      1 to 724
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab84769 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: 150mM Imidazole
    Constituents: 25% Glycerol, 50mM Sodium phosphate, 300mM Sodium chloride, 2mM DTT, 0.1mM PMSF, pH 7.0

General Info

  • Alternative names
    • GRB1
    • p85
    • p85 alpha
    • P85A_HUMAN
    • Phosphatidylinositol 3 kinase associated p 85 alpha
    • Phosphatidylinositol 3 kinase regulatory 1
    • Phosphatidylinositol 3 kinase, regulatory subunit, polypeptide 1 (p85 alpha)
    • Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha
    • Phosphatidylinositol 3-kinase regulatory subunit alpha
    • Phosphoinositide 3 kinase, regulatory subunit 1 (alpha)
    • PI3 kinase p85 subunit alpha
    • PI3-kinase regulatory subunit alpha
    • PI3-kinase subunit p85-alpha
    • PI3K
    • PI3K regulatory subunit alpha
    • Pik3r1
    • PtdIns 3 kinase p85 alpha
    • PtdIns-3-kinase regulatory subunit alpha
    • PtdIns-3-kinase regulatory subunit p85-alpha
    see all
  • Function
    Binds to activated (phosphorylated) protein-Tyr kinases, through its SH2 domain, and acts as an adapter, mediating the association of the p110 catalytic unit to the plasma membrane. Necessary for the insulin-stimulated increase in glucose uptake and glycogen synthesis in insulin-sensitive tissues.
  • Tissue specificity
    Isoform 2 is expressed in skeletal muscle and brain, and at lower levels in kidney and cardiac muscle. Isoform 2 and isoform 4 are present in skeletal muscle (at protein level).
  • Sequence similarities
    Belongs to the PI3K p85 subunit family.
    Contains 1 Rho-GAP domain.
    Contains 2 SH2 domains.
    Contains 1 SH3 domain.
  • Domain
    The SH3 domain mediates the binding to CBLB, and to HIV-1 Nef.
  • Post-translational
    modifications
    Polyubiquitinated in T-cells by CBLB; which does not promote proteasomal degradation but impairs association with CD28 and CD3Z upon T-cell activation.
    Phosphorylated. Dephosphorylated by PTPRJ.
  • Information by UniProt

Images

  • SDS-PAGE showing ab84769 at approximately 86kDa.

References

ab84769 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you for contacting us.

Please find attached the answers in the attached document.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up