Recombinant Human PI 3 Kinase regulatory subunit 4 protein (ab153319)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AGSDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQ KVGPSDDTPRRGPESLPVGHHDIITDVATFQTTQGFIVTASRDGIVKVWK
    • Amino acids
      1259 to 1358
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153319 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC102700
    • P150
    • Phosphatidylinositol 3 kinase associated p150
    • Phosphatidylinositol 3 kinase regulatory subunit polypeptide 4
    • Phosphatidylinositol 3 kinase regulatory subunit polypeptide 4 p150
    • Phosphoinositide 3 kinase adaptor protein
    • Phosphoinositide 3 kinase regulatory subunit 4
    • Phosphoinositide 3 kinase regulatory subunit 4 p150
    • Phosphoinositide 3 kinase regulatory subunit polypeptide 4
    • Phosphoinositide 3 kinase regulatory subunit polypeptide 4 p150
    • Phosphoinositide 3-kinase adaptor protein
    • Phosphoinositide 3-kinase regulatory subunit 4
    • PI3 kinase p150 subunit
    • PI3-kinase p150 subunit
    • PI3-kinase regulatory subunit 4
    • PI3R4_HUMAN
    • PIK3R 4
    • PIK3R4
    • VPS 15
    • VPS15
    see all
  • Function
    Regulatory subunit of the PI3K complex. May regulate membrane trafficking late in the endocytic pathway.
  • Tissue specificity
    Ubiquitously expressed.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
    Contains 3 HEAT repeats.
    Contains 1 protein kinase domain.
    Contains 7 WD repeats.
  • Post-translational
    modifications
    Myristoylated.
    Probably autophosphorylated.
  • Information by UniProt

Images

  • ab153319 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153319 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153319.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up