Overview

  • Product name
    Recombinant Human PI3R6 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GKSFSTVTNTFRTNNIQIQSRDQRLLTLSLDKDDQRTFRDVVRFEVAPCP EPCSGAQKSKAPWLNLHGQQEVEAIKAKPKPLLMPINTFSGIVQ
    • Amino acids
      661 to 754
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165540 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C17orf38
    • Chromosome 17 open reading frame 38
    • HsT41028
    • p84 PI3K adapter protein
    • p84 PIKAP
    • p87 phosphoinositide 3-kinase gamma (PI3Kg) adapter protein
    • p87 PI3K adapter protein
    • p87PIKAP
    • Phosphatidylinositol 3-kinase, regulatory subunit 6
    • Phosphoinositide 3-kinase gamma adapter protein of 87 kDa
    • Phosphoinositide 3-kinase regulatory subunit 6
    • PI3Kgamma adapter protein of 87 kDa
    • PI3R6_HUMAN
    • PIK3R6
    see all
  • Function
    Regulatory subunit of the PI3K gamma complex. Acts as an adapter to drive activation of PIK3CG by beta-gamma G protein dimers. The PIK3CG:PIK3R6 heterodimer is much less sensitive to beta-gamma G protein dimers than PIK3CG:PIK3R5 and its membrane recruitment and beta-gamma G protein dimer-dependent activation requires HRAS1 bound to PIK3CG. Recruits of the PI3K gamma complex to a PDE3B:RAPGEF3 signaling complex involved in angiogenesis; signaling seems to involve RRAS.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab165540 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165540 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165540.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up