Recombinant Human PI4 kinase beta protein (ab152610)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GGLDGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSST IRNLKERFHMSMTEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGIM
    • Amino acids
      731 to 828
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152610 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp686O1820
    • FLJ30129
    • NPIK
    • Phosphatidylinositol 4 kinase beta
    • Phosphatidylinositol 4 kinase catalytic beta
    • Phosphatidylinositol 4 kinase catalytic beta polypeptide
    • Phosphatidylinositol 4 kinase wortmannin sensitive
    • Phosphatidylinositol 4-kinase beta
    • PI4K BETA
    • PI4K-beta
    • PI4K92
    • PI4KB
    • PI4KB_HUMAN
    • PI4Kbeta
    • PI4KIIIbeta
    • PIK4CB
    • PtdIns 4 kinase
    • PtdIns 4-kinase beta
    • Type III phosphatidylinositol 4 kinase beta
    see all
  • Function
    Phosphorylates phosphatidylinositol (PI) in the first committed step in the production of the second messenger inositol-1,4,5,-trisphosphate (PIP). May regulate Golgi disintegration/reorganization during mitosis, possibly via its phosphorylation. Involved in Golgi-to-plasma membrane trafficking.
  • Tissue specificity
    Widely expressed with highest levels in heart, skeletal muscle, pancreas, testis and ovary. Weakly expressed in liver.
  • Sequence similarities
    Belongs to the PI3/PI4-kinase family. Type III PI4K subfamily.
    Contains 1 PI3K/PI4K domain.
    Contains 1 PIK helical domain.
  • Cellular localization
    Endomembrane system. Mitochondrion outer membrane. Rough endoplasmic reticulum membrane. Golgi apparatus. Cytoplasm, perinuclear region. Found in the outer membrane of mitochondria and membranes of the rough endoplasmic reticulum. Recruited to the Golgi complex by the small GTPase ARF to stimulate the synthesis of phosphatidylinositol 4,5-bisphosphate (PIP2) on the Golgi complex.
  • Information by UniProt

Images

  • ab152610 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152610 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152610.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up