Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCS PAVQMKIKELYRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYD GHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQKLPFYDLLDEL IKPTSLASDNSQRFRETCFAFALTPQQVQQISSSMDISGTKCDFTVQVQL RFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNGVEPKRPSRPI NITSLVRLSTTVPNTIVVSWTAEIGRNYSMAVYLVKQLSSTVLLQRLRAK GIRNPDHSRALIKEKLTADPDSEIATTSLRVSLLCPLGKMRLTIPCRALT CSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILKYCT DCDEIQFKEDGTWAPMRSKKEVQEVSASYNGVDGCLSSTLEHQVASHHQS SNKNKKVEVIDLTIDSSSDEEEEEPSAKRTCPSLSPTSPLNNKGILSLPH QASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDLQGLDFFPFLS GDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTS LPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISL D
    • Molecular weight
      98 kDa including tags
    • Amino acids
      1 to 651

Specifications

Our Abpromise guarantee covers the use of ab152888 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AR interacting protein
    • DDXBP1
    • DEAD/H (Asp-Glu-Ala-Asp/His) box binding protein 1
    • DEAD/H box binding protein 1
    • DEAD/H box-binding protein 1
    • E3 SUMO-protein ligase PIAS1
    • GBP
    • Gu binding protein
    • Gu-binding protein
    • GU/RH-II
    • Pias1
    • PIAS1_HUMAN
    • Protein inhibitor of activated STAT protein 1
    • Protein inhibitor of activated STAT, 1
    • RNA helicase II binding protein
    • RNA helicase II-binding protein
    • Zinc finger, MIZ-type containing 3
    • ZMIZ3
    see all
  • Function
    Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. Plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53 pathway and the steroid hormone signaling pathway. In vitro, binds A/T-rich DNA. The effects of this transcriptional coregulation, transactivation or silencing, may vary depending upon the biological context. Together with PRMT1, may repress STAT1 transcriptional activity, in the late phase of interferon gamma (IFN-gamma) signaling.
  • Tissue specificity
    Expressed in numerous tissues with highest level in testis.
  • Pathway
    Protein modification; protein sumoylation.
  • Sequence similarities
    Belongs to the PIAS family.
    Contains 1 PINIT domain.
    Contains 1 SAP domain.
    Contains 1 SP-RING-type zinc finger.
  • Domain
    The LXXLL motif is a transcriptional coregulator signature.
    The SP-RING-type domain is required for promoting EKLF sumoylation.
  • Post-translational
    modifications
    Sumoylated.
    Dimethylated by PRMT1 at Arg-303 in the late phase of interferon gamma (IFN-gamma) signaling, leading to preferential interaction with STAT1 and thus resulting in release of STAT1 from its target gene.
  • Cellular localization
    Nucleus speckle. Interaction with CSRP2 may induce a partial redistribution along the cytoskeleton.
  • Information by UniProt

Images

  • Lane 1 : Anti-PIAS1 antibody [EPR2580(2)] (ab109388) at 1/500 dilution
    Lane 2 : Anti-GST antibody [EPR4236] (ab111947) at 1/2000 dilution

    All lanes : Recombinant Human PIAS1 protein (ab152888)

    Lysates/proteins at 0.01 µg per lane.

    Secondary
    All lanes : Goat Anti-Rabbit IgG H&L (HRP) (ab97051) at 1/20000 dilution

    Observed band size: 98 kDa (why is the actual band size different from the predicted?)



    Exposure time:

    Lane 1: 10 seconds.

    Lane 2: 1 minute.

     

    Blocking and dilution buffer: 5% NFDM/TBST.

  • 12.5% SDS-PAGE analysis of ab152888 stained with Coomassie Blue.

References

ab152888 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152888.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up