Recombinant Human PIB5PA protein (ab162085)

Overview

  • Product name
    Recombinant Human PIB5PA protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FLLQFAFRDDMPLVRLEVADEWVRPEQAVVRYRMETVFARSSWDWIGLYR VGFRHCKDYVAYVWAKHEDVDGNTYQVTFSEESLPKGHGDFILGYYSHNH SILIGITEPF
    • Amino acids
      361 to 470
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162085 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5-bisphosphate 5-phosphatase A
    • Inositol polyphosphate 5-phosphatase
    • Inositol polyphosphate 5-phosphatase J
    • INPP5
    • Inpp5j
    • Phosphatidylinositol 4
    • Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A
    • PI5PA_HUMAN
    • PIB5PA
    • PIPP
    see all
  • Function
    Inositol 5-phosphatase, which converts inositol 1,4,5-trisphosphate to inositol 1,4-bisphosphate. Also converts phosphatidylinositol 4,5-bisphosphate to phosphatidylinositol 4-phosphate and inositol 1,3,4,5-tetrakisphosphate to inositol 1,3,4-trisphosphate in vitro. May be involved in modulation of the function of inositol and phosphatidylinositol polyphosphate-binding proteins that are present at membranes ruffles.
  • Sequence similarities
    Belongs to the inositol 1,4,5-trisphosphate 5-phosphatase type II family.
  • Domain
    The 5 Arg-Ser-Xaa-Ser-Xaa-Xaa (RSXSXX) motifs may constitute binding sites for the 14-3-3 protein.
  • Cellular localization
    Cytoplasm. Predominantly localized to membrane ruffles.
  • Information by UniProt

Images

  • ab162085 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162085 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162085.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up