Recombinant Human PICALM protein (ab152848)

Overview

  • Product name
    Recombinant Human PICALM protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTN EMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASR NTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKR GADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLL FKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEF LKVAEQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKKIKDSTAASRAT TLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKP HTSLTTAASPVSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPT FHPSVHPMSTASQVASTWGGFTPSPVAQPHPSAGLNVDFESVFGNKSTNV IVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLANLVGN LGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMNGMHFPQ YAPPVMAYPATTPTGMIGYGIPPQMGSVPVMTQPTLIYSQPVMRPPNPFG PVSGAQIQFM
    • Molecular weight
      93 kDa including tags
    • Amino acids
      1 to 610

Specifications

Our Abpromise guarantee covers the use of ab152848 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CALM
    • Clathrin assembly lymphoid myeloid leukemia
    • Clathrin assembly lymphoid myeloid leukemia protein
    • CLTH
    • LAP
    • Phosphatidylinositol-binding clathrin assembly protein
    • PICAL_HUMAN
    • PICALM
    see all
  • Function
    Assembly protein recruiting clathrin and adaptor protein complex 2 (AP2) to cell membranes at sites of coated-pit formation and clathrin-vesicle assembly. May be required to determine the amount of membrane to be recycled, possibly by regulating the size of the clathrin cage. Involved in AP2-dependent clathrin-mediated endocytosis at the neuromuscular junction.
  • Tissue specificity
    Expressed in all tissues examined.
  • Involvement in disease
    Note=A chromosomal aberration involving PICALM is found in diffuse histiocytic lymphomas. Translocation t(10;11)(p13;q14) with MLLT10.
  • Sequence similarities
    Contains 1 ENTH (epsin N-terminal homology) domain.
  • Cellular localization
    Membrane > clathrin-coated pit. Golgi apparatus. Cytoplasmic vesicle > clathrin-coated vesicle. Colocalized with clathrin in the Golgi area.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152848 stained with Coomassie Blue.

References

ab152848 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152848.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up