Overview

  • Product name
    Recombinant Human PIGA protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LRAALNPEIVSVIPNAVDPTDFTPDPFRRHDSITIVVVSRLVYRKGIDLL SGIIPELCQKYPDLNFIIGGEGPKRIILEEVRERYQLHDRVRLLGALEHK
    • Amino acids
      194 to 293
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159119 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Class A GlcNAc inositol phospholipid assembly protein
    • GlcNAc PI synthesis protein
    • GlcNAc-PI synthesis protein
    • GPI3
    • MCAHS2
    • Phosphatidylinositol glycan anchor biosynthesis class A
    • Phosphatidylinositol glycan biosynthesis class A protein
    • Phosphatidylinositol N-acetylglucosaminyltransferase subunit A
    • Phosphatidylinositol-glycan biosynthesis class A protein
    • PIG A
    • PIG-A
    • Piga
    • PIGA_HUMAN
    see all
  • Function
    Necessary for the synthesis of N-acetylglucosaminyl-phosphatidylinositol, the very early intermediate in GPI-anchor biosynthesis.
  • Pathway
    Glycolipid biosynthesis; glycosylphosphatidylinositol-anchor biosynthesis.
  • Involvement in disease
    Paroxysmal nocturnal hemoglobinuria (PNH) [MIM:300818]: A disorder characterized by hemolytic anemia with hemoglobinuria, thromboses in large vessels, and a deficiency in hematopoiesis. Clinical manifestation of red blood cell breakdown with release of hemoglobin into the urine is manifested most prominently by dark-colored urine in the morning. Note=The disease is caused by mutations affecting the gene represented in this entry.
    Multiple congenital anomalies-hypotonia-seizures syndrome 2 (MCAHS2) [MIM:300868]: An X-linked recessive developmental disorder characterized by dysmorphic features, neonatal hypotonia, myoclonic seizures, and variable congenital anomalies involving the central nervous, cardiac, and urinary systems. Most affected individuals die in infancy. Note=The disease is caused by mutations affecting the gene represented in this entry.
  • Sequence similarities
    Belongs to the glycosyltransferase group 1 family. Glycosyltransferase 4 subfamily.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab159119 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159119 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159119.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up