Overview

  • Product name
    Recombinant Human PIGG protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EHQTWYFLVNTLCLALSQETYRNYFLGDDGEPPCGLCVEQGHDGATAAWQ GGPGCDVLERDKGHGSPSTSEVLRGREKW
    • Amino acids
      566 to 644
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162868 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp434A1810
    • DKFZp434C1712
    • DKFZp434M1131
    • FLJ20265
    • FLJ39925
    • GPI ethanolamine phosphate transferase 2
    • GPI7
    • GPI7 homolog
    • hGPI7
    • LAS21
    • MGC131903
    • Phosphatidylinositol glycan anchor biosynthesis class G
    • Phosphatidylinositol glycan class G
    • Phosphatidylinositol-glycan biosynthesis class G protein
    • PIG-G
    • PIGG
    • PIGG_HUMAN
    • PRO4405
    • RLGS1930
    see all
  • Function
    Ethanolamine phosphate transferase involved in glycosylphosphatidylinositol-anchor biosynthesis. Transfers ethanolamine phosphate to the GPI second mannose.
  • Pathway
    Glycolipid biosynthesis; glycosylphosphatidylinositol-anchor biosynthesis.
  • Sequence similarities
    Belongs to the PIGG/PIGN/PIGO family. PIGG subfamily.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab162868 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162868 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162868.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up