Overview

  • Product name
    Recombinant Human PIGO protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDSGEWEVSNQHVLGVDHCGHKHGPHHPEMAKKLSQMDQVIQGLVERLEN DTLLVVAGDHGMTTNGDHGGDSELEVSAALFLYSPTAVFPSTPPEEPEVI PQVSLVPTLALLLGLPIPFGNIGEVMAELFSGGEDSQPHSSALAQASALH LNAQQVSRFLHTYSAATQDLQAKELHQLQNLFSKASADYQWLLQSPKGAE ATLPTVIAELQQFLRGARAMCIESWARFSLSFLLLHLLAAGIPVTTPGPF TVPWQAVSAWALMATQTFYSTGHQPVFPAIHWHAAFVGFPEGHGSCTWLP ALLVGANTFASHLLFAVGCPLLLLWPFLCESQGLRKRQQPPGNEADARVR PEEEEEPLMEMRLRDAPQHFYAALLQLGLKYLFILGIQILACALAASILR RHLMVWKVFAPKFIFEAVGFIVSSVGLLLGIALVMRVDGAVSSWFRQLFL AQQR
    • Amino acids
      1 to 454
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164649 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp434M222
    • FLJ00135
    • FLJ00350
    • GPI ethanolamine phosphate transferase 3
    • mFLJ00350
    • MGC20536
    • MGC3079
    • OTTHUMP00000021324
    • OTTHUMP00000021325
    • OTTMUSP00000007085
    • Phosphatidylinositol glycan anchor biosynthesis class O
    • Phosphatidylinositol glycan biosynthesis class O protein
    • Phosphatidylinositol glycan class O
    • Phosphatidylinositol-glycan biosynthesis class O protein
    • PIG O
    • PIG-O
    • PIGO
    • PIGO_HUMAN
    • RP11-182N22.4
    • RP23-124L1.7
    see all
  • Function
    Ethanolamine phosphate transferase involved in glycosylphosphatidylinositol-anchor biosynthesis. Transfers ethanolamine phosphate to the GPI third mannose which links the GPI-anchor to the C-terminus of the proteins by an amide bond.
  • Pathway
    Glycolipid biosynthesis; glycosylphosphatidylinositol-anchor biosynthesis.
  • Sequence similarities
    Belongs to the PIGG/PIGN/PIGO family. PIGO subfamily.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab164649 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164649 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164649.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up