Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLA AKELYTKN
    • Amino acids
      77 to 134
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162465 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DCRC
    • DCRC S
    • Down syndrome critical region gene 5
    • Down syndrome critical region protein 5
    • Down syndrome critical region protein C
    • DSCR 5
    • DSCR5
    • DSCRC
    • DSRC
    • Phosphatidylinositol glycan anchor biosynthesis class P
    • Phosphatidylinositol glycan biosynthesis class P
    • Phosphatidylinositol glycan biosynthesis class P protein
    • Phosphatidylinositol glycan class P
    • Phosphatidylinositol n acetylglucosaminyltranferase subunit
    • Phosphatidylinositol N acetylglucosaminyltransferase subunit P
    • Phosphatidylinositol N-acetylglucosaminyltransferase subunit P
    • Phosphatidylinositol-glycan biosynthesis class P protein
    • PIG-P
    • PIGP
    • PIGP_HUMAN
    see all
  • Function
    Part of the complex catalyzing the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis.
  • Tissue specificity
    Ubiquitous.
  • Pathway
    Glycolipid biosynthesis; glycosylphosphatidylinositol-anchor biosynthesis.
  • Sequence similarities
    Belongs to the PIGP family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab162465 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162465 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162465.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up