Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EPPRDSLREELVITPLPSGDVAATFQFRTRWDSELQREGVSHYRLFPKAL GQLISKYSLRELHLSFTQGFWRTRYWGPPFLQAPSGAELWVWFQDTVTDV
    • Amino acids
      24 to 123
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162609 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CGI 06
    • FLJ41596
    • GPI transamidase component PIG T
    • GPI transamidase subunit
    • MGC8909
    • NDAP
    • Neurotrophin regulated neuronal development associated protein
    • Phosphatidyl inositol glycan class T
    • Phosphatidylinositol glycan anchor biosynthesis class T
    • Phosphatidylinositol glycan class T
    see all
  • Relevance
    PIGT is an essential component of the multisubunit enzyme, GPI transamidase and is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells which serves to anchor proteins to the cell surface. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins.
  • Cellular localization
    Endoplasmic reticulum membrane; Single-pass type I membrane protein.

Images

  • ab162609 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162609 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162609.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up