Overview

  • Product name
    Recombinant Human Pigu protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DFNKVVFKKQKLLLELDQYAPDVAELIRTPMEMRYIPLKVALFYLLNPYT ILSCVAKSTCAINNT
    • Amino acids
      101 to 165
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165310 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5430426F17Rik
    • BC028278
    • Cdc91l1
    • Cell division cycle 91 like 1 protein
    • Cell division cycle protein 91-like 1
    • GAB1
    • GPI transamidase component PIG-U
    • GPI transamidase subunit
    • Phosphatidylinositol glycan anchor biosynthesis class U
    • Phosphatidylinositol glycan anchor biosynthesis class U protein
    • Pigu
    • PIGU_HUMAN
    • Protein CDC91 like 1
    • Protein CDC91-like 1
    see all
  • Function
    Component of the GPI transamidase complex. May be involved in the recognition of either the GPI attachment signal or the lipid portion of GPI.
  • Pathway
    Glycolipid biosynthesis; glycosylphosphatidylinositol-anchor biosynthesis.
  • Sequence similarities
    Belongs to the PIGU family.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab165310 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165310 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165310.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up