Overview

  • Product name
    Recombinant Human PIGV protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MWPQDPSRKEVLRFAVSCRILTLMLQALFNAIIPDHHAEAFSPPRLAPSG FVDQLVEGLLGGLSHWDAEHFLFIAEHGYLYEHNFAFFPGFPLALLVGTE LLRPLRGLLSLRSCLLISVASLNFLFFMLAAVALHDLGCLVLHCPHQSFY AALLFCLSPANVFLAAGYSEALFALLTFSAMGQLERGRVWTSVLLFAFAT GVRSNGLVSVGFLMHSQCQGFFSSLTMLNPLRQLFKLMASLFLSVFTLGL PFALFQYYAYTQFCLPGSARPIPEPLVQLAVDKGYRIAEGNEPPWCFWDV PLIYSYIQDVYWNVGFLKYYELKQVPNFLLAAPVAILVAWATWTYVTTHP WLCLTLGLQRSKNNKTLEKPDLGFLSPQVFVYVVHAAVLLLFGGLCMHVQ VLTRFLGSSTPIMYWFPAHLLQDQEPLLRSLKTVPWKPLAEDSPPGQKVP RNPIMGLLYHWKTCSPVTRYILGYFLTYWLLGLLLHCNFLPWT
    • Amino acids
      1 to 493
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163163 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GPI mannosyltransferase 2
    • GPI mannosyltransferase II
    • GPI MT II
    • GPI-MT-II
    • Phosphatidylinositol glycan biosynthesis class V protein
    • Phosphatidylinositol-glycan biosynthesis class V protein
    • PIG-V
    • Pigv
    • PIGV_HUMAN
    see all
  • Function
    Alpha-1,6-mannosyltransferase involved in glycosylphosphatidylinositol-anchor biosynthesis. Transfers the second mannose to the glycosylphosphatidylinositol during GPI precursor assembly.
  • Pathway
    Glycolipid biosynthesis; glycosylphosphatidylinositol-anchor biosynthesis.
  • Involvement in disease
    Defects in PIGV are the cause of hyperphosphatasia with mental retardation (HPMR) [MIM:239300]. It is a syndrome characterized by elevated serum alkaline phosphatase, severe mental retardation, seizures, hypotonia, facial dysmorphism, and hypoplastic terminal phalanges.
  • Sequence similarities
    Belongs to the PIGV family.
  • Post-translational
    modifications
    Not N-glycosylated.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab163163 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163163 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163163.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up