Recombinant Human PIK3AP1 protein (ab165145)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRFFTSVACYGSCLFASELLIRCKDWLKGRPALFTALLACVLYLCEWTGA KHVPGSSYVEMLQASTSNPIPGDGFSRATKDSMIRKFLEGNSMGMTNLER DQCHLGQEEDVYHTVDDDEAFSVDLASRPPVPVPRPETTAPGAHQLPDNE PYIFKVFAEKSQERPGNFYVSSESIRKGPPVRPWRDRPQSSIYDPFAGMK TPGQRQLITLQEQVKLGIVNVDEAVLHFKEWQLNQKKRSESFRFQQENLK RLRDSITRRQREKQKSGKQTDLEITVPIRHSQHLPAKVEFGVYESGPRKS VIPPRTELRRGDWKTDSTSSTASSTSNRSSTRSLLSVSSGMEGDNEDNEV PEVTRSRSPGPPQVDGTPTMSLERPPRVPPRAASQRPPTRETFHPPPPVP PRGR
    • Amino acids
      1 to 404
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165145 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • B cell adaptor protein
    • B-cell adapter for phosphoinositide 3-kinase
    • B-cell phosphoinositide 3-kinase adapter protein 1
    • BCAP
    • BCAP_HUMAN
    • OTTHUMP00000020175
    • OTTHUMP00000020176
    • Phosphoinositide 3 kinase adaptor protein 1
    • Phosphoinositide 3-kinase adapter protein 1
    • PIK3AP1
    • RP11-34E5.3
    see all
  • Function
    Involved in the activation of phosphoinositide 3-kinase (PI3K) in B-cells and in natural killer (NK) cells. Couples B-cell antigen receptor (BCR) to PI3K activation by providing a docking site for the PI3K subunit PIK3R1, which contributes to B-cell development. Seems to have a complementary role with CD19 in PI3K activation (By similarity). May be involved in the survival of mature B cells via activation of REL.
  • Tissue specificity
    Expressed in natural killer (NK) cells.
  • Sequence similarities
    Contains 1 DBB domain.
  • Domain
    The DBB domain is required for dimerization.
  • Post-translational
    modifications
    Phosphorylated on tyrosine residues within the YXXM motifs by BTK and SYK (By similarity). Isoform 1 and isoform 2 are phosphorylated on tyrosine residues, most likely within the YXXM motifs, via CD19 activation (By similarity). Phosphorylated on tyrosine residues in C-terminus region by ABL1 and V-abl.
  • Cellular localization
    Cytoplasm. Cell membrane.
  • Information by UniProt

Images

  • ab165145 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165145 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165145.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up