Recombinant Human PIK3R5 protein (ab161675)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDSGYVEDSEESSSEWPWRRGSQERRGHRRPGQKFIRIYKLFKSTSQLVL RRDSRSLEGSSDTALPLRRAGSLCSPLDEPVSPPSRAQRSRSLPQPKLGT QLPSWLLAPASRPQRRRPFLSGDEDPKASTLRVVVFGSDRISGKVARAYS NLRRLENNRPLLTRFFKLQFFYVPVKRSHGTSPGACPPPRSQTPSPPTDS PRHASPGELGTTPWEESTNDISHYLGMLDPWYERNVLGLMHLPPEVLCQQ SLKAEAQALEGSPTQLPILADMLLYYCRFAARPVLLQVYQTELTFITGEK TTEIFIHSLELGHSAATRAIKASGPGSKRLGIDGDREAVPLTLQIIYSKG AISGRSRWSNLEKVCTSVNLNKACRKQEELDSSMEALTLNLTEVVKRQNS KSKKGFNQISTSQIKVDKVQIIGSNSCPFAVCLDQDERKILQSVVRCEVS PCYKPEKSDLSSPPQTPPDLPAQAAPDLCSLLCLPIMTFSGALP
    • Amino acids
      1 to 494
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161675 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5-bisphosphate 3-kinase regulatory subunit
    • F730038I15Rik
    • FOAP 2
    • FOAP2
    • OTTHUMP00000135339
    • p101
    • P101 PI3K
    • p101-PI3K
    • Phosphatidylinositol 4
    • Phosphatidylinositol 4,5 bisphosphate 3 kinase regulatory subunit
    • Phosphoinositide 3 kinase, regulatory subunit 5
    • Phosphoinositide 3 kinase, regulatory subunit 5, p101
    • Phosphoinositide 3 kinase, regulatory subunit, polypeptide p101
    • Phosphoinositide 3-kinase regulatory subunit 5
    • PI3 kinase p101 subunit
    • PI3 kinase regulatory subunit 5
    • PI3-kinase p101 subunit
    • PI3-kinase regulatory subunit 5
    • PI3R5_HUMAN
    • PIK3 R5
    • PIK3R5
    • Protein FOAP 2
    • Protein FOAP-2
    • PtdIns 3 kinase p101
    • PtdIns 3 kinase regulatory subunit
    • PtdIns-3-kinase p101
    • PtdIns-3-kinase regulatory subunit
    see all
  • Function
    Regulatory subunit of the PI3K gamma complex.
  • Tissue specificity
    Ubiquitously expressed with high expression in fetal brain compared to adult brain. Abundant expression is observed in cerebellum, cerebral cortex, cerebral meninges, and vermis cerebelli.
  • Involvement in disease
    Note=Defects in PIK3R5 may be a cause of autosomal recessive ataxia with oculomotor apraxia (AOA). A PIK3R5 mutation segregates with the disease phenotype in a family affected by gait ataxia, cerebellar dysarthric speech, and impaired ocular movement. Additional features include reduced or absent tendon reflexes, severe cerebellar atrophy, marked vermal atrophy, moderately severe axonal sensory polyneuropathy with absent sensory nerve action potential in the lower extremities, and persistently elevated alpha-fetoprotein levels.
  • Domain
    The heterodimerization region allows the binding to the catalytic subunit.
  • Cellular localization
    Nucleus. Cytoplasm. Membrane.
  • Information by UniProt

Images

  • ab161675 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161675 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161675.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up