Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHP WMLGADGGAPESCDLRLCTLDPDDVASTTSSSESL
    • Amino acids
      242 to 326
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153649 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Kid 1
    • Kid1
    • Kinase induced by depolarization
    • ONCOGENE PIM3
    • PIM 3
    • Pim 3 oncogene
    • Pim-3 proto-oncogene, serine/threonine kinase
    • PIM3
    • Pim3 oncogene
    • PIM3_HUMAN
    • Protein kinase Kid 1
    • Protein kinase Kid1
    • Serine/threonine kinase Pim 3
    • Serine/threonine kinase Pim3
    • Serine/threonine protein kinase Pim 3
    • Serine/threonine protein kinase Pim3
    • Serine/threonine-protein kinase Pim-3
    see all
  • Function
    Able to phosphorylate CDKN1B in vitro. Involved in cell cycle progression and suppression of apoptosis. Implicated in proliferation of human hepatoma cell lines.
  • Tissue specificity
    Widely expressed. No expression in colon, thymus, and small intestine. Expressed in human hepatoma cell lines but not in normal liver tissues. Expressed in colon cancer samples, particularly at the less advanced stages of cancer development.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. PIM subfamily.
    Contains 1 protein kinase domain.
  • Information by UniProt

Images

  • ab153649 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153649 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153649.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up