Recombinant human Pin1 protein (ab51230)

Overview

  • Product nameRecombinant human Pin1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQG EPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGE EDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPV FTDSGIHIILRTE

Specifications

Our Abpromise guarantee covers the use of ab51230 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activitySpecific activity is > 330 nmoles/min/mg, and is defined as the amount of enzyme that cleaves 1 µmole of suc-AAFP-pNA per minute at 25°C in Tris-Hcl pH8.0 using chymotrypsin.

    Activity Assay

    1. 1. Prepare 180ul assay buffer into a suitable container: 133mM Tris-HCl, pH8.0, 5.5nM chymotrypsin, and 0.5ug of Pin1 recombinant protein.
    2. For blanks, load 133mM Tris-HCl, pH8.0 and 5.5nM chymotrypsin. (Enzyme dilution buffer: 133mM Tris-HCl, pH8.0)
    3. 2. Add 20ul of 5mM suc-AAFP-pNA to each well.
    4. (Substrate has to be dissolved in buffer of 460mM Lithium chloride in 3mM 2,2,2-Trifluoroethnol)
    5. 3. Incubated at room temperature for 10minutes.
    6. 4. Record the increase in A405 nm for 30 minutes at 37°C.
  • Note: Specific activity is lot specific and is always > 330 nmoles/min/mg, and is defined as the amount of enzyme that cleaves 1 µmole of suc-AAFP-pNA per minute at 25°C in Tris-Hcl pH8.0 using chymotrypsin. Please inquire about lot specific activity
  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level< 1.000 Eu/µg
  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 7.5

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • DOD
    • DODO, Drosophila, homolog of
    • FLJ40239
    • FLJ77628
    • MGC10717
    • NIMA interacting 1
    • Peptidyl prolyl cis trans isomerase NIMA interacting 1
    • Peptidyl prolyl cis/trans isomerase NIMA interacting
    • Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
    • Peptidyl-prolyl cis-trans isomerase pin1
    • Peptidylprolyl cis/trans isomerase NIMA interacting 1
    • Pin 1
    • Pin1
    • PIN1_HUMAN
    • PPIase Pin1
    • Prolyl isomerase
    • Protein (peptidylprolyl cis/trans isomerase) NIMA interacting 1
    • Protein NIMA interacting 1
    • Rotamase Pin1
    • UBL 5
    • UBL5
    see all
  • FunctionEssential PPIase that regulates mitosis presumably by interacting with NIMA and attenuating its mitosis-promoting activity. Displays a preference for an acidic residue N-terminal to the isomerized proline bond. Catalyzing pSer/Thr-Pro cis/trans isomerizations.
  • Sequence similaritiesContains 1 PpiC domain.
    Contains 1 WW domain.
  • DomainThe WW domain is required for the interaction with STIL and KIF20B.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant human Pin1 protein images

  • ab51230 run on a 14% SDS-PAGE gel with molecular weight markers.

References for Recombinant human Pin1 protein (ab51230)

ab51230 has not yet been referenced specifically in any publications.

Product Wall

You can dilute the protein in the same storage buffer in which the product is received. This buffer contains:
Preservative: None
Constituents: 20% Glycerol, 0.1M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 7.5
Please remember to keep freeze...

Read More

The product ab51230 does not come with an assay kit and we unfortunately do not have one in our catalogue. If you follow the instructions on the website though, you should be able to perform the assay.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"