Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMPMAGLLKGLVRQLEQFRVQQQASKMPPKG KSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAM EKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSG MDKPVFTDPPVKTKFGYHIIMVEGRK
    • Molecular weight
      19 kDa including tags
    • Amino acids
      1 to 156
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab186986 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

General Info

  • Alternative names
    • EPVH
    • Eukaryotic parvulin homolog
    • hEPVH
    • hPar14
    • hPar17
    • MGC138486
    • OTTHUMP00000023527
    • OTTHUMP00000217483
    • OTTHUMP00000217485
    • Par14
    • Par17
    • Parvulin 14
    • Parvulin-14
    • Parvulin-17
    • Peptidyl prolyl cis trans isomerase NIMA interacting 4
    • Peptidyl prolyl cis/trans isomerase EPVH
    • Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4
    • Peptidyl-prolyl cis-trans isomerase PIN4
    • Peptidyl-prolyl cis/trans isomerase EPVH
    • PIN4
    • PIN4_HUMAN
    • PPIase Pin4
    • Protein (peptidylprolyl cis/trans isomerase) NIMA interacting, 4 (parvulin)
    • Rotamase Pin4
    see all
  • Function
    Isoform 1 is involved as a ribosomal RNA processing factor in ribosome biogenesis. Binds to tightly bent AT-rich stretches of double-stranded DNA.
    Isoform 2 binds to double-stranded DNA.
  • Tissue specificity
    Isoform 2 is much more stable than isoform 1 (at protein level). Ubiquitous. Isoform 1 and isoform 2 are expressed in kidney, liver, blood vessel, brain, mammary gland, skeletal muscle, small intestine and submandibularis. Isoform 1 transcripts are much more abundant than isoform 2 in each tissue analyzed.
  • Sequence similarities
    Belongs to the ppiC/parvulin rotamase family. PIN4 subfamily.
    Contains 1 PpiC domain.
  • Domain
    The PPIase domain enhances mitochondrial targeting.
  • Post-translational
    modifications
    Phosphorylated. Isoform 1 phosphorylation occurs both in the nucleus and the cytoplasm. Isoform 1 phosphorylation at Ser-19 does not affect its PPIase activity but is required for nuclear localization, and the dephosphorylation is a prerequisite for the binding to DNA. The unphosphorylated isoform 1 associates with the pre-rRNP complexes in the nucleus.
    Isoform 2 is sumoylated by SUMO2 and SUMO3.
  • Cellular localization
    Mitochondrion. Mitochondrion matrix. Imported in a time- and membrane potential-dependent manner to the mitochondrial matrix, but without concomitant processing of the protein. Directed to mitochondria by a novel N-terminal domain that functions as non-cleavable mitochondrial targeting peptide and Nucleus > nucleolus. Cytoplasm > cytoskeleton > spindle. Cytoplasm. Colocalizes in the nucleolus during interphase and on the spindle apparatus during mitosis with NPM1.
  • Information by UniProt

References

ab186986 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186986.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up