Overview

  • Product nameRecombinant Human Pinin protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9H307
    • SpeciesHuman
    • SequenceAKQTELRLLEQKVELAQLQEEWNEHNAKIIKYIRTKTKPHLFYIPGRMCP ATQKLIEESQRKMNALFEGRRIEFAEQINKMEARPRRQSMKEKEHQVVRN
    • Molecular weight37 kDa including tags
    • Amino acids201 to 300

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114826 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 140 kDa nuclear and cell adhesion-related phosphoprotein
    • Desmosome-associated protein
    • Domain-rich serine protein
    • DRS
    • DRS protein
    • DRSP
    • Melanoma metastasis clone A protein
    • MEMA
    • Nuclear protein SDK3
    • Pinin
    • PININ_HUMAN
    • PNN
    • SR like protein
    • SR-like protein
    see all
  • FunctionTranscriptional activator binding to the E-box 1 core sequence of the E-cadherin promoter gene; the core-binding sequence is 5'CAGGTG-3'. Capable of reversing CTBP1-mediated transcription repression. Component of a splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of a few core proteins and several more peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Participates in the regulation of alternative pre-mRNA splicing. Associates to spliced mRNA within 60 nt upstream of the 5'-splice sites. Involved in the establishment and maintenance of epithelia cell-cell adhesion. Potential tumor suppressor for renal cell carcinoma.
  • Tissue specificityExpressed in placenta, lung, liver, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine, colon, heart, epidermis, esophagus, brain and smooth and skeletal muscle. Expressed strongly in melanoma metastasis lesions and advanced primary tumors.
  • Sequence similaritiesBelongs to the pinin family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationNucleus speckle. Cell junction > desmosome. Cell-cell contact area, predominantly desmosome of intercellular adherens junction. Not a nucleocytoplasmic shuttling protein.
  • Information by UniProt

Recombinant Human Pinin protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human Pinin protein (ab114826)

ab114826 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114826.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"