Recombinant Human PIP protein (denatured) (ab171678)

Overview

  • Product name
    Recombinant Human PIP protein (denatured)
  • Protein length
    Full length protein
  • Description
    Recombinant Human PIP protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSQDNTRKIIIKNFDIPKSVRPNDEVTAV LAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTN RTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE
    • Molecular weight
      16 kDa including tags
    • Amino acids
      28 to 146
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab171678 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names
    • GCDFP15
    • GP17
    • Gross cystic disease fluid protein 15
    • Prolactin induced protein
    • Prolactin inducible protein
    • SABP
    • Secretory actin binding protein
    see all
  • Relevance
    Gross cystic disease of the breast is a benign premenopausal disorder in which cysts are a predominant pathological lesion. These cysts appear to be formed from excessive aporcine cystic secretions. This fluid is composed of several glycoproteins including a unique 15kD monomer protein, PIP. Cytosolic analysis of normal tissue specimens from all major organs has demonstrated PIP in aporcine epithelia, lacrimal, ceruminous and Moll’s glands and in numerous serous cells of the submandibular, tracheal, bronchial, sublingual and minor salivary glands. PIP and prostate specific antigen are co-expressed in androgen receptor-positive breast tumors.
  • Cellular localization
    Cytoplasmic and Secreted

Images

  • 15% SDS-PAGE analysis of ab171678 (3µg).

References

ab171678 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171678.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up