Recombinant Human PIP5K1 alpha protein (ab160016)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASASSGPSSSVGFSSFDPAVPSCTLSSASGIKRPMASEVPYASGMPIKK IGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDF YVVESIFFPSEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYLY SLCSEPLIELCSSGASGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYM NLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVKMHIKYDLKGS TYKRRASQKEREKPLPTFKDLDFLQDIPDGLFLDADMYNALCKTLQRDCL VLQSFKIMDYSLLMSIHNIDHAQREPLSSETQYSVDTRRPAPQKALYSTA MESIQGEARRGGTMETDDHMGGIPARNSKGERLLLYIGIIDILQSYRFVK KLEHSWKALVHDGDTVSVHRPGFYAERFQRFMCNTVFKKIPCVHLGRPDV LPQTPPLEEISEGSPIPDPSFSPLVGETLQMLTTSTTLEKLEVAESEFTH
    • Amino acids
      1 to 500
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160016 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 68 kDa type I phosphatidylinositol-4-phosphate 5-kinase alpha
    • Phosphatidylinositol 4 phosphate 5 kinase type I alpha
    • Phosphatidylinositol-4-phosphate 5-kinase type I alpha
    • Phosphatidylinositol-4-phosphate 5-kinase type-1 alpha
    • PI4P5K Ia
    • PI51A_HUMAN
    • PIP5K A
    • PIP5K1-alpha
    • Pip5k1a
    • PIP5KIalpha
    • PtdIns(4)P-5-kinase 1 alpha
    see all
  • Function
    Participates in the biosynthesis of phosphatidylinositol-4,5-bisphosphate. Mediates RAC1-dependent reorganization of actin filaments. Acts as an activator of TUT1 adenylyltransferase activity in nuclear speckles, thereby regulating mRNA polyadenylation of a select set of mRNAs. Contributes to the activation of PLD2.
  • Tissue specificity
    Highly expressed in heart, placenta, skeletal muscle, kidney and pancreas. Detected at lower levels in brain, lung and liver.
  • Sequence similarities
    Contains 1 PIPK domain.
  • Cellular localization
    Cell membrane. Endomembrane system. Golgi apparatus > Golgi stack. Nucleus speckle. Associated with the plasma membrane and with internal membranes. Associated with Golgi stacks (By similarity). Detected on RAC1-induced plasma membrane ruffles, and on membrane ruffles induced by platelet-derived growth factor. Localizes to nuclear speckles and associates with TUT1 to regulate polyadenylation of selected mRNAs.
  • Information by UniProt

Images

  • ab160016 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160016 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160016.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up