Recombinant Human PIP5K3 protein (ab165864)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MATDDKTSPTLDSANDLPRSPTSPSHLTHFKPLTPDQDEPPFKSAYSSFV NLFRFNKERAEGGQGEQQPLSGSWTSPQLPSRTQSVRSPTPYKKQLNEEL QRRSSALGDLRACTYCRKIALSYAHSTDSNSIGEDLNALSDSACSVSVLD PSEPRTPVGSRKASRNIFLEDDLAWQSLIHPDSSNTPLSTRLVSVQEDAG KSPARNRSASITNLSLDRSGSPMVPSYETSVSPQANRTYVRTETTEDERK ILLDSVQLKDLWKKICHHSSGMEFQDHRYWLRTHPNCIVGKELVNWLIRN GHIATRAQAIAIGQAMVDGRWLDCVSHHDQLFRDEYALYRPLQSTEFSET PSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQIAEEGDDNLANSASPSKR TSVSSFQSTVDSDSAASISLNVELDNVNFHIKKPSKYPHVPPHPADQKGR R
    • Amino acids
      1 to 451
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165864 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1 phosphatidylinositol 3 phosphate 5 kinase
    • 1 phosphatidylinositol 4 phosphate 5 kinase
    • 1-phosphatidylinositol 3-phosphate 5-kinase
    • CFD
    • epididymis luminal protein 37
    • FAB1
    • FAB1, S. cerevisiae, homolog of
    • FYV1_HUMAN
    • FYVE finger containing phosphoinositide kinase
    • FYVE finger-containing phosphoinositide kinase
    • KIAA0981
    • MGC40423
    • p235
    • Phosphatidylinositol 3 phosphate 5 kinase type III
    • Phosphatidylinositol 3 phosphate/phosphatidylinositol 5 kinase type III
    • Phosphatidylinositol 3-phosphate 5-kinase
    • Phosphatidylinositol 3-phosphate 5-kinase type III
    • Phosphatidylinositol 4 phosphate 5 kinase type III
    • Phosphoinositide kinase, FYVE finger containing
    • PIKfyve
    • PIP5K
    • PIP5K3
    • PIPkin III
    • PIPkin-III
    • PtdIns(4)P 5 kinase
    • Type III PIP kinase
    • ZFYVE29
    • Zinc finger, FYVE domain containing 29
    see all
  • Function
    The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2). Catalyzes the phosphorylation of phosphatidylinositol 3-phosphate on the fifth hydroxyl of the myo-inositol ring, to form phosphatidylinositol 3,5-bisphosphate. Required for endocytic-vacuolar pathway and nuclear migration. Plays a role in the biogenesis of endosome carrier vesicles (ECV)/ multivesicular bodies (MVB) transport intermediates from early endosomes.
  • Involvement in disease
    Corneal dystrophy, fleck
  • Sequence similarities
    Contains 1 DEP domain.
    Contains 1 FYVE-type zinc finger.
    Contains 1 PIPK domain.
  • Cellular localization
    Endosome membrane. Mainly associated with membranes of the late endocytic pathway.
  • Information by UniProt

Images

  • ab165864 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165864 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165864.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up