Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAATAREDGASGQERGQRGCEHYDRGCLLKAPCCDKLYTCRLCHDNNEDH QLDRFKVKEVQCINCEKIQHAQQTCEECSTLFGEYYCDICHLFDKDKKQY HCENCGICRIGPKEDFFHCLKCNLCLAMNLQGRHKCIENVSRQNCPICLE DIHTSRVVAHVLPCGHLLHRGYRCPLCMHSALDMTRYWRQLDDEVAQTPM PSEYQNMTVDILCNDCNGRSTVQFHILGMKCKICESYNTAQAGGRRISLD QQ
    • Amino acids
      1 to 252
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161829 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Androgen receptor N terminal interacting protein
    • Androgen receptor N-terminal-interacting protein
    • ARNIP
    • CH-rich-interacting match with PLAG1
    • CHIMP
    • E3 ubiquitin-protein ligase Pirh2
    • hARNIP
    • hPirh2
    • p53 induced protein with a RING H2 domain
    • p53-induced RING-H2 protein
    • PIRH2E
    • PIRH2F
    • PRO1996
    • RCHY1
    • Ring finger and CHY zinc finger domain containing 1 E3 ubiquitin protein ligase
    • RING finger and CHY zinc finger domain-containing protein 1
    • RING finger protein 199
    • RNF199
    • ZCHY
    • ZFP 363
    • zinc finger CHY type
    • Zinc finger protein 363
    • ZN363_HUMAN
    • ZNF363
    see all
  • Function
    Mediates E3-dependent ubiquitination and proteasomal degradation of target proteins, including p53/TP53, HDAC1 and CDKN1B. Preferentially acts on tetrameric p53/TP53. Contributes to the regulation of CDKN1B and p53/TP53 levels, and thereby contributes to the regulation of the cell cycle progression. Increases AR transcription factor activity.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 CHY-type zinc finger.
    Contains 1 CTCHY-type zinc finger.
    Contains 1 RING-type zinc finger.
  • Post-translational
    modifications
    Subject to ubiquitination and proteasomal degradation. Interaction with PLAGL2 or KAT5 enhances protein stability.
  • Cellular localization
    Nucleus. Nucleus speckle. Cytoplasm.
  • Information by UniProt

Images

  • ab161829 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161829 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161829.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up