Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO00625
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSSKKVTLSVLSREQSEGVGARVRRSIGR PELKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEGGSMAHEDFCG HTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQ YQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGA KHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVEN KDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFER AKTWKSKIGN
    • Molecular weight34 kDa including tags
    • Amino acids1 to 290
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab123170 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab123170 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • 3-dioxygenase PIR
    • Iron binding nuclear protein
    • Pir
    • PIR_HUMAN
    • Pirin
    • Probable quercetin 2
    • probable quercetin 2,3-dioxygenase PIR
    • Probable quercetinase
    see all
  • FunctionPossible transcriptional coregulator. May contribute to the regulation of cellular processes via its interaction with BCL3. May be required for efficient terminal myeloid maturation of hematopoietic cells. May play a role in the regulation of cell migration. May promote apoptosis when overexpressed. Has quercetin 2,3-dioxygenase activity (in vitro).
  • Tissue specificityHighly expressed in a subset of melanomas. Detected at very low levels in most tissues (at protein level). Expressed in all tissues, with highest level of expression in heart and liver.
  • PathwayFlavonoid metabolism; quercetin degradation.
  • Sequence similaritiesBelongs to the pirin family.
  • Cellular localizationNucleus. Cytoplasm. Predominantly localized in dot-like subnuclear structures. Cytoplasmic localization of PIR seems to positively correlate with melanoma progression.
  • Information by UniProt

Recombinant Human Pirin protein images

  • 15% SDS-PAGE showing ab123170 at approximately 34.3kDa (3µg).

References for Recombinant Human Pirin protein (ab123170)

ab123170 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab123170.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"