Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP28069
    • SpeciesHuman
    • SequenceMSCQAFTSADTFIPLNSDASATLPLIMHHSAAECLPVSNHATNVMSTATG LHYSVPSCHYGNQPSTYGVMAGSLTPCLYKFPDHTLSHGFPPIHQPLLAE DPTAADFKQELRRKSKLVEEPIDMDSPEIRELEKFANEFKVRRIKLGYTQ TNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQV GALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAEE LNLEKEVVRVWFCNRRQREKRVKTSLNQSLFSISKEHLECR
    • Molecular weight58 kDa including tags
    • Amino acids1 to 291

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114764 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/ul.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Dwarf
    • GHF 1
    • GHF 1A
    • GHF-1
    • GHF1
    • GHF1A
    • Growth hormone factor 1
    • Hmp 1
    • Hmp1
    • Pit 1
    • Pit 1 beta
    • PIT 1Z
    • PiT-1
    • Pit1 beta
    • PIT1_HUMAN
    • PIT1Z
    • Pituitary growth hormone
    • Pituitary specific positive transcription factor 1
    • Pituitary-specific positive transcription factor 1
    • POU class 1 homeobox 1
    • POU domain class 1 transcription factor 1
    • POU domain transcriptional regulator
    • POU1F1
    see all
  • FunctionTranscription factor involved in the specification of the lactotrope, somatotrope, and thyrotrope phenotypes in the developing anterior pituitary. Activates growth hormone and prolactin genes. Specifically binds to the consensus sequence 5'-TAAAT-3'.
  • Involvement in diseaseDefects in POU1F1 are the cause of pituitary hormone deficiency combined type 1 (CPHD1) [MIM:613038]. CPHD is characterized by impaired production of growth hormone (GH) and one or more of the other five anterior pituitary hormones.
  • Sequence similaritiesBelongs to the POU transcription factor family. Class-1 subfamily.
    Contains 1 homeobox DNA-binding domain.
    Contains 1 POU-specific domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human Pit1 protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab114764 at approximately 58.08kDa.

References for Recombinant Human Pit1 protein (ab114764)

ab114764 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114764.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"