Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      NACKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALER HFGEQNKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLF SISKEHLECR
    • Molecular weight
      38 kDa including tags
    • Amino acids
      182 to 291

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152622 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Dwarf
    • GHF 1
    • GHF 1A
    • GHF-1
    • GHF1
    • GHF1A
    • Growth hormone factor 1
    • Hmp 1
    • Hmp1
    • Pit 1
    • Pit 1 beta
    • PIT 1Z
    • PiT-1
    • Pit1 beta
    • PIT1_HUMAN
    • PIT1Z
    • Pituitary growth hormone
    • Pituitary specific positive transcription factor 1
    • Pituitary-specific positive transcription factor 1
    • POU class 1 homeobox 1
    • POU domain class 1 transcription factor 1
    • POU domain transcriptional regulator
    • POU1F1
    see all
  • Function
    Transcription factor involved in the specification of the lactotrope, somatotrope, and thyrotrope phenotypes in the developing anterior pituitary. Activates growth hormone and prolactin genes. Specifically binds to the consensus sequence 5'-TAAAT-3'.
  • Involvement in disease
    Defects in POU1F1 are the cause of pituitary hormone deficiency combined type 1 (CPHD1) [MIM:613038]. CPHD is characterized by impaired production of growth hormone (GH) and one or more of the other five anterior pituitary hormones.
  • Sequence similarities
    Belongs to the POU transcription factor family. Class-1 subfamily.
    Contains 1 homeobox DNA-binding domain.
    Contains 1 POU-specific domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152622 stained with Coomassie Blue.

References

ab152622 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152622.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up