Recombinant Human PITPNB protein (ab101091)

Overview

  • Product name
    Recombinant Human PITPNB protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMVLIKEFRVVLPCSVQEYQVGQLYSVAEAS KNETGGGEGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPAFVRMIAPEGS LVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDP NTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKE LANSPDCPQMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNFHRQLFC WIDKWIDLTMEDIRRMEDETQKELETMRKRGSVRGTSAADV
    • Molecular weight
      34 kDa including tags
    • Amino acids
      1 to 271
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101091 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab101091 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: 0% None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • OTTHUMP00000198846
    • OTTHUMP00000198847
    • Phosphatidylinositol transfer protein beta isoform
    • Phosphatidylinositol transfer protein, beta
    • PI TP beta
    • PI-TP-beta
    • PIPNB_HUMAN
    • Pitpnb
    • PtdIns transfer protein beta
    • PtdInsTP
    • PtdInsTP beta
    • VIB1B
    see all
  • Function
    Catalyzes the transfer of PtdIns and phosphatidylcholine between membranes.
  • Tissue specificity
    Widely expressed in various tissues including brain.
  • Sequence similarities
    Belongs to the PtdIns transfer protein family. PI transfer class I subfamily.
  • Post-translational
    modifications
    Constitutive phosphorylation of Ser-262 has no effect on phospholipid transfer activity but is required for Golgi targeting.
  • Cellular localization
    Cytoplasm. Golgi apparatus.
  • Information by UniProt

Recombinant Human PITPNB protein images

  • 15% SDS-PAGE analysis of ab101091 (3µg)

References for Recombinant Human PITPNB protein (ab101091)

ab101091 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101091.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up