Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP78337
    • SpeciesHuman
    • SequenceMPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVY RDTCNSSLASLRLKSKQHSSFGYGALQGPASGLNACQYN
    • Molecular weight35 kDa including tags
    • Amino acids225 to 313

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114745 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BFT
    • CCF
    • Hindlimb expressed homeobox protein backfoot
    • Hindlimb-expressed homeobox protein backfoot
    • Homeobox protein PITX1
    • LBNBG
    • Paired like homeodomain 1
    • Paired like homeodomain transcription factor 1
    • Paired-like homeodomain transcription factor 1
    • Pituitary homeo box 1
    • Pituitary homeobox 1
    • Pituitary otx related factor
    • Pitx1
    • PITX1_HUMAN
    • POTX
    • PTX1
    see all
  • FunctionMay play a role in the development of anterior structures, and in particular, the brain and facies and in specifying the identity or structure of hindlimb.
  • Involvement in diseaseDefects in PITX1 are a cause of congenital clubfoot (CCF) [MIM:119800]; also known as talipes equinovarus (TEV). Clubfoot is a congenital limb deformity defined as fixation of the foot in cavus, adductus, varus, and equinus (i.e. inclined inwards, axially rotated outwards, and pointing downwards) with concomitant soft tissue abnormalities. Clubfoot may occur in isolation or as part of a syndrome. Clubfoot appears to be a multifactorial trait.
  • Sequence similaritiesBelongs to the paired homeobox family. Bicoid subfamily.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human PITX1 protein images

  • 12.5% SDS-PAGE showing ab114745 at approximately 35.42kDa.
    Stained with Coomassie Blue.

References for Recombinant Human PITX1 protein (ab114745)

ab114745 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114745.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"