Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNCMKGPLHLEHRAAGTKLSAVSSSSCHHPQPLAMASVLAPGQPRSLDSS KHRLEVHTISDTSSPEAAEKDKSQQGKNEDVGAEDPSKKKRQRRQRTHFT SQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKR ERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKS FPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMVPSAVTGVPGSSLNSLN NLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSSLASLRLKAKQHSS FGYASVQNPASNLSACQYAVDRPV
    • Amino acids
      1 to 324
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152611 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • All1 responsive gene 1
    • ALL1 responsive protein ARP1
    • ALL1-responsive protein ARP1
    • ARP 1
    • ARP1
    • Brx 1
    • Brx1
    • Homeobox protein PITX2
    • IDG 2
    • IDG2
    • IGDS
    • IGDS 2
    • IGDS2
    • IHG 2
    • IHG2
    • IRID 2
    • IRID2
    • MGC111022
    • MGC20144
    • Otlx 2
    • Otlx2
    • Paired like homeodomain transcription factor 2
    • Paired-like homeodomain transcription factor 2
    • Pituitary homeo box 2
    • Pituitary homeobox 2
    • PITX 2
    • pitx2
    • PITX2_HUMAN
    • PTX 2
    • PTX2
    • RGS
    • RIEG
    • RIEG 1
    • RIEG bicoid related homeobox transcription factor
    • Rieg bicoid related homeobox transcription factor 1
    • RIEG bicoid-related homeobox transcription factor
    • RIEG1
    • RS
    • Solurshin
    see all
  • Function
    May play an important role in development and maintenance of anterior structures. Isoform PTX2C is involved in left-right asymmetry the developing embryo.
  • Involvement in disease
    Defects in PITX2 are the cause of Axenfeld-Rieger syndrome type 1 (RIEG1) [MIM:180500]; also known as Rieger syndrome type 1. RIEG1 is an autosomal dominant defect characterized by hypodontia (partial anodontia), anal stenosis, hypertelorism, mental deficiency, agenesis of the facial bones, with malformation of the anterior chamber of the eye.
    Defects in PITX2 are the cause of iridogoniodysgenesis type 2 (IRID2) [MIM:137600]; also known as iridogoniodysgenesis syndrome 2 (IGDS2). It is an autosomal dominant inherited disease.
    Defects in PITX2 are a cause of Peters anomaly (PAN) [MIM:604229]. It is a congenital defect of the anterior chamber of the eye.
    Defects in PITX2 are associated with ring dermoid of cornea (RDC) [MIM:180550]. RDC is an autosomal dominantly inherited syndrome characterized by bilateral annular limbal dermoids with corneal and conjunctival extension.
  • Sequence similarities
    Belongs to the paired homeobox family. Bicoid subfamily.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab152611 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152611 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152611.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up