Recombinant Human PKA 2 beta (regulatory subunit) protein (ab152631)

Overview

  • Product name
    Recombinant Human PKA 2 beta (regulatory subunit) protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      IAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYFGEL ALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQL VALFGTNMDI
    • Molecular weight
      38 kDa including tags
    • Amino acids
      304 to 413

Specifications

Our Abpromise guarantee covers the use of ab152631 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AI451071
    • AW061005
    • cAMP dependent protein kinase type II beta regulatory chain
    • cAMP dependent protein kinase type II beta regulatory subunit
    • cAMP-dependent protein kinase type II-beta regulatory subunit
    • H RG363E19.2
    • KAP3_HUMAN
    • MGC116401
    • Pkarb2
    • PRKAR 2
    • PRKAR2
    • PRKAR2B
    • Protein kinase cAMP dependent regulatory type II beta
    • RATDNA
    • RII beta
    • RII(beta)
    • RIIbeta
    • WUGSC:H RG363E19.2
    see all
  • Function
    Regulatory subunit of the cAMP-dependent protein kinases involved in cAMP signaling in cells. Type II regulatory chains mediate membrane association by binding to anchoring proteins, including the MAP2 kinase.
  • Tissue specificity
    Four types of regulatory chains are found: I-alpha, I-beta, II-alpha, and II-beta. Their expression varies among tissues and is in some cases constitutive and in others inducible.
  • Sequence similarities
    Belongs to the cAMP-dependent kinase regulatory chain family.
    Contains 2 cyclic nucleotide-binding domains.
  • Post-translational
    modifications
    Phosphorylated by the activated catalytic chain.
  • Cellular localization
    Cytoplasm. Cell membrane. Co-localizes with PJA2 in the cytoplasm and at the cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab152631 stained with Coomassie Blue.

References

ab152631 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152631.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up