Recombinant Human PKA R2 protein (ab159196)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVL PAATPRQSLGHPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSV CAETY
    • Amino acids
      1 to 105
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159196 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • cAMP dependent protein kinase regulatory subunit alpha 2
    • cAMP dependent protein kinase regulatory subunit RII alpha
    • cAMP dependent protein kinase type II alpha regulatory chain
    • cAMP dependent protein kinase type II alpha regulatory subunit
    • cAMP-dependent protein kinase type II-alpha regulatory subunit
    • KAP2
    • KAP2_HUMAN
    • MGC3606
    • PKR 2
    • PKR2
    • PRKA R2
    • PRKAR 2
    • PRKAR2
    • PRKAR2A
    • Protein kinase A RII alpha subunit
    • Protein kinase cAMP dependent regulatory type II alpha
    see all
  • Function
    Regulatory subunit of the cAMP-dependent protein kinases involved in cAMP signaling in cells. Type II regulatory chains mediate membrane association by binding to anchoring proteins, including the MAP2 kinase.
  • Tissue specificity
    Four types of regulatory chains are found: I-alpha, I-beta, II-alpha, and II-beta. Their expression varies among tissues and is in some cases constitutive and in others inducible.
  • Sequence similarities
    Belongs to the cAMP-dependent kinase regulatory chain family.
    Contains 2 cyclic nucleotide-binding domains.
  • Post-translational
    modifications
    Phosphorylated by the activated catalytic chain.
  • Cellular localization
    Cytoplasm. Cell membrane. Colocalizes with PJA2 in the cytoplasm and the cell membrane.
  • Information by UniProt

Images

  • ab159196 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159196 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159196.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up