Recombinant Human PKC epsilon protein (ab151935)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVW LSKEAVSILKAFMTKNPHKRLGCVASQNGEDAIKQHPFFKEIDWVLLEQK KIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQINQEEFKGFS YFGEDLMP
    • Molecular weight
      18 kDa
    • Amino acids
      580 to 737

Associated products

Specifications

Our Abpromise guarantee covers the use of ab151935 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab151935 has purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. 0.2 µM filtered.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.02% DTT, 0.88% Sodium chloride

General Info

  • Alternative names
    • KPCE_HUMAN
    • MGC125656
    • MGC125657
    • nPKC epsilon
    • nPKC-epsilon
    • PKCE
    • Pkcea
    • PRKCE
    • Protein kinase C epsilon
    • Protein kinase C epsilon type
    see all
  • Function
    This is calcium-independent, phospholipid-dependent, serine- and threonine-specific enzyme.
    PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters.
  • Sequence similarities
    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 1 C2 domain.
    Contains 2 phorbol-ester/DAG-type zinc fingers.
    Contains 1 protein kinase domain.
  • Domain
    The C1 domain, containing the phorbol ester/DAG-type region 1 (C1A) and 2 (C1B), is the diacylglycerol sensor and the C2 domain is a non-calcium binding domain.
  • Post-translational
    modifications
    Phosphorylation on Thr-566 by PDPK1 triggers autophosphorylation on Ser-729.
  • Information by UniProt

References

ab151935 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151935.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up