Recombinant Human PKC zeta protein (ab159213)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KLLVHKRCHGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSEETDGIAY ISSSRKHDSIKDDSEDLKPVIDGMDGIKISQGLGLQDFDLI
    • Amino acids
      165 to 255
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159213 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 14-3-3-zetaisoform
    • AI098070
    • aPKCzeta
    • C80388
    • EC 2.7.11.13
    • KPCZ_HUMAN
    • nPKC zeta
    • nPKC-zeta
    • OTTHUMP00000001368
    • OTTHUMP00000044160
    • PKC 2
    • PKC ZETA
    • PKC2
    • Pkcz
    • PKCZETA
    • PKM-zeta, included
    • PRKCZ
    • Protein kinase C zeta
    • Protein kinase C zeta form
    • Protein kinase C zeta type
    • r14-3-3
    • R74924
    • zetaPKC
    see all
  • Function
    This is a calcium-independent, phospholipid-dependent, serine- and threonine-specific enzyme. Phosphorylates 'Ser-311' of RELA subunit of NF-kappa-B.
    PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters. Subunit of a quaternary complex that plays a central role in epithelial cell polarization.
  • Tissue specificity
    Expressed in brain, and to a lesser extent in lung, kidney and testis.
  • Sequence similarities
    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 1 OPR domain.
    Contains 1 phorbol-ester/DAG-type zinc finger.
    Contains 1 protein kinase domain.
  • Domain
    The OPR domain mediates mutually exclusive interactions with SQSTM1 and PARD6B.
    The C1 domain does not bind the diacylglycerol (DAG).
  • Post-translational
    modifications
    CDH5 is required for its phosphorylation at Thr-410.
  • Cellular localization
    Cytoplasm. Endosome. Cell junction. In the retina, localizes in the terminals of the rod bipolar cells (By similarity). Associates with endosomes. Presence of KRIT1, CDH5 and RAP1B is required for its localization to the cell junction.
  • Information by UniProt

Images

  • ab159213 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159213 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159213.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up