Recombinant Human PKHD1L1 protein (ab164931)

Overview

  • Product name
    Recombinant Human PKHD1L1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KATDSDGNCVSVGITALTLRAILKDSNNNQVNGLSGNTTIPFSSCWANYT DLTPLRTGKNYKIEFILDNVVGVESRTFSLLA
    • Amino acids
      4105 to 4186
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164931 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp586C1021
    • Fibrocystin-L
    • OTTHUMP00000227951
    • PKHD1-like protein 1
    • Pkhd1l1
    • PKHL1_HUMAN
    • polycystic kidney and hepatic disease 1 (autosomal recessive)-like 1
    • Polycystic kidney and hepatic disease 1-like protein 1
    • polycystic kidney and hepatic disease-like 1
    see all
  • Tissue specificity
    Ubiquitous. Expressed in spleen and thymus as well as in activated T-cells and B lymphoblasts.
  • Sequence similarities
    Contains 2 G8 domains.
    Contains 14 IPT/TIG domains.
    Contains 9 PbH1 repeats.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab164931 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164931 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164931.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up