Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMRTDSSKMTDVESGVANFASSARAGRRNAL PDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQLEKPQNEEK
    • Molecular weight
      11 kDa
    • Amino acids
      1 to 98
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105619 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab105619 was purified using conventional chromatography
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • cAMP dependent protein kinase inhibitor 2
    • cAMP-dependent protein kinase inhibitor beta
    • FLJ23817
    • IPKB_HUMAN
    • OTTHUMP00000017115
    • OTTHUMP00000017116
    • OTTHUMP00000017117
    • PKI-beta
    • PKIB
    • PRKACN2
    • Protein kinase (cAMP dependent, catalytic) inhibitor beta
    see all
  • Function
    Extremely potent competitive inhibitor of cAMP-dependent protein kinase activity, this protein interacts with the catalytic subunit of the enzyme after the cAMP-induced dissociation of its regulatory chains.
  • Sequence similarities
    Belongs to the PKI family.
  • Information by UniProt

Images

  • ab105619 at 3 µg analysed by 15% SDS-PAGE. Predicted molecular weight is 10.6 kDa but molecular weight on SDS-PAGE will appear higher.

References

ab105619 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab105619.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up