Recombinant Human PKM2 protein (BSA and azide free) (ab178466)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MKHHHHHHASKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITA RNTGIICTIGPASRSVETLKEMIKSGMNVARLNFSHGTHEYHAETIKNVR TATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKI TLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADF LVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFA SFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMV ARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTR AEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAIYHL QLFEELRRLAPITSDPTEATAVGAVEASFKCCSGAIIVLTKSGRSAHQVA RYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRVNF AMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP
    • Molecular weight
      59 kDa including tags
    • Amino acids
      2 to 531
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab178466 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Mass Spectrometry

    SDS-PAGE

    Western blot

  • Endotoxin level
    < 1.000 Eu/µg
  • Mass spectrometry
    LC-MS/MS
  • Purity
    > 90 % Densitometry.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

  • Reconstitution
    Add 200 µl of deionized water to prepare a working stock solution of 0.5 mg/mL and let the lyophilized pellet dissolve completely. ab178466 is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.

General Info

  • Alternative names
    • CTHBP
    • Cytosolic thyroid hormone binding protein
    • Cytosolic thyroid hormone-binding protein
    • KPYM_HUMAN
    • MGC3932
    • OIP 3
    • OIP-3
    • OIP3
    • OPA interacting protein 3
    • Opa-interacting protein 3
    • p58
    • PK muscle type
    • PK, muscle type
    • PK2
    • PK3
    • PKM
    • PKM2
    • pykm
    • Pyruvate kinase 2/3
    • Pyruvate kinase 3
    • Pyruvate kinase isozymes M1/M2
    • Pyruvate kinase muscle
    • Pyruvate kinase muscle isozyme
    • pyruvate kinase PKM
    • Pyruvate kinase, muscle 2
    • TCB
    • THBP1
    • Thyroid hormone binding protein 1
    • Thyroid hormone binding protein cytosolic
    • Thyroid hormone-binding protein 1
    • Tumor M2 PK
    • Tumor M2-PK
    see all
  • Function
    Glycolytic enzyme that catalyzes the transfer of a phosphoryl group from phosphoenolpyruvate (PEP) to ADP, generating ATP. Stimulates POU5F1-mediated transcriptional activation. Plays a general role in caspase independent cell death of tumor cells. The ratio between the highly active tetrameric form and nearly inactive dimeric form determines whether glucose carbons are channeled to biosynthetic processes or used for glycolytic ATP production. The transition between the 2 forms contributes to the control of glycolysis and is important for tumor cell proliferation and survival.
  • Tissue specificity
    Specifically expressed in proliferating cells, such as embryonic stem cells, embryonic carcinoma cells, as well as cancer cells.
  • Pathway
    Carbohydrate degradation; glycolysis; pyruvate from D-glyceraldehyde 3-phosphate: step 5/5.
  • Sequence similarities
    Belongs to the pyruvate kinase family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
    ISGylated.
  • Cellular localization
    Cytoplasm. Nucleus. Translocates to the nucleus in response to different apoptotic stimuli. Nuclear translocation is sufficient to induce cell death that is caspase independent, isoform-specific and independent of its enzymatic actvity.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab178466

    1) Reduced and heated sample, 2.5 μg/lane

    2) Non-reduced and non-heated sample, 2.5 μg/lane.

References

ab178466 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab178466.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up