Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASDAVQSEPRSWSLLEQLGLAGADLAAPGVQQQLELERERLRREIRKEL KLKEGAENLRRATTDLGRSLGPVELLLRGSSRRLDLLHQQLQELHAHVVL PDPAATHDGPQSPGAGGPTCSATNLSRVAGLEKQLAIELKVKQGAENMIQ TYSNGSTKDRKLLLTAQQMLQDSKTKIDIIRMQLRRALQAGQLENQAAPD DTQGSPDLGAVELRIEELRHHFRVEHAVAEGAKNVLRLLSAAKAPDRKAV SEAQEKLTESNQKLGLLREALERRLGELPADHPKGRLLREELAAASSAAF STRLAGPFPATHYSTLCKPAPLTGTLEVRVVGCRDLPETIPWNPTPSMGG PGTPDSRPPFLSRPARGLYSRSGSLSGRSSLKAEAENTSEVSTVLKLDNT VVGQTSWKPCGPNAWDQSFTLELERARELELAVFWRDQRGLCALKFLKLE DFLDNERHEVQLDMEPQGCLVAEVTFRNPVIERIPRLRRQKKIFSKQQGK AFQRARQMNIDVATWVRLLRRLIPNATGTGTFSPGASPGSEARTTGDISV EKLNLGTDSDSSPQKSSRDPPSSPSSLSSPIQESTAPELPSETQETPGPA LCSPLRKSPLTLEDFKFLAVLGRGHFGKVLLSEFRPSGELFAIKALKKGD IVARDEVESLMCEKRILAAVTSAGHPFLVNLFGCFQTPEHVCFVMEYSAG GDLMLHIHSDVFSEPRAIFYSACVVLGLQFLHEHKIVYRDLKLDNLLLDT EGYVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTDTSYTRAVDWWG LGVLLYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSAEAIGIMRRLL RRNPERRLGSSERDAEDVKKQPFFRTLGWEALLARRLPPPFVPTLSGRTD ISNFDEEFTGEAPTLSPPRDARPLTAAEQAAFLDFDFVAGGC
    • Amino acids
      1 to 942
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159206 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DBK
    • PAK 1
    • PAK-1
    • PAK1
    • PKC1
    • PKN
    • PKN ALPHA
    • Pkn1
    • PKN1_HUMAN
    • PRK1
    • PRKCL1
    • Protease activated kinase 1
    • Protease-activated kinase 1
    • Protein kinase C like 1
    • Protein kinase C like PKN
    • Protein kinase C related kinase 1
    • Protein kinase C-like 1
    • Protein kinase C-like PKN
    • Protein kinase N1
    • Protein kinase PKN alpha
    • Protein kinase PKN-alpha
    • Protein-kinase C-related kinase 1
    • Serine threonine kinase N
    • Serine threonine protein kinase N
    • Serine-threonine protein kinase N
    • Serine/threonine protein kinase N1
    • Serine/threonine-protein kinase N1
    see all
  • Function
    PKC-related serine/threonine-protein kinase involved in various processes such as regulation of the intermediate filaments of the actin cytoskeleton, cell migration, tumor cell invasion and transcription regulation. Regulates the cytoskeletal network by phosphorylating proteins such as VIM and neurofilament proteins NEFH, NEFL and NEFM, leading to inhibit their polymerization. Phosphorylates 'Ser-575', 'Ser-637' and 'Ser-669' of MAPT/Tau, lowering its ability to bind to microtubules, resulting in disruption of tubulin assembly. Acts as a key coactivator of androgen receptor (ANDR)-dependent transcription, by being recruited to ANDR target genes and specifically mediating phosphorylation of 'Thr-11' of histone H3 (H3T11ph), a specific tag for epigenetic transcriptional activation that promotes demethylation of histone H3 'Lys-9' (H3K9me) by KDM4C/JMJD2C. Phosphorylates HDAC5, HDAC7 and HDAC9, leading to impair their import in the nucleus. Phosphorylates 'Thr-38' of PPP1R14A, 'Ser-159', 'Ser-163' and 'Ser-170' of MARCKS, and GFAP. Able to phosphorylate RPS6 in vitro.
  • Tissue specificity
    Found ubiquitously. Expressed in heart, brain, placenta, lung, skeletal muscle, kidney and pancreas. Expressed in numerous tumor cell lines, especially in breast tumor cells.
  • Sequence similarities
    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 1 C2 domain.
    Contains 1 protein kinase domain.
    Contains 3 REM (Hr1) repeats.
  • Domain
    The C1 domain does not bind the diacylglycerol (DAG).
  • Post-translational
    modifications
    Autophosphorylated; preferably on serine. Phosphorylated during mitosis.
    Activated by limited proteolysis with trypsin.
  • Cellular localization
    Cytoplasm. Nucleus. Endosome. Cell membrane. Cleavage furrow. Midbody. Associates with chromatin in a ligand-dependent manner. Localization to endosomes is mediated via its interaction with RHOB. Association to the cell membrane is dependent on Ser-374 phosphorylation. Accumulates during telophase at the cleavage furrow and finally concentrates around the midbody in cytokinesis.
  • Information by UniProt

Images

  • ab159206 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159206 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159206.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up